Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6370
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CCL25   Gene   UCSC   Ensembl
Aliases Ckb15, SCYA25, TECK
Gene name C-C motif chemokine ligand 25
Alternate names C-C motif chemokine 25, Ck beta-15, TECKvar, chemokine (C-C motif) ligand 25, chemokine TECK, small inducible cytokine subfamily A (Cys-Cys), member 25, small-inducible cytokine A25, thymus expressed chemokine,
Gene location 19p13.2 (8052317: 8062662)     Exons: 7     NC_000019.10
Gene summary(Entrez) This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]
OMIM 602565

Protein Summary

Protein general information O15444  

Name: C C motif chemokine 25 (Chemokine TECK) (Small inducible cytokine A25) (Thymus expressed chemokine)

Length: 150  Mass: 16,609

Tissue specificity: Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.

Sequence MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVC
GNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Structural information
Interpro:  IPR034133 IPR001811

Pfam:  
PF00048
CDD:   cd01119

DIP:  
5883
MINT:   106224
STRING:   ENSP00000375086;
Other Databases GeneCards:  CCL25;  Malacards:  CCL25

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001954 positive regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0002548 monocyte chemotaxis
IBA biological_process
GO:0005179 hormone activity
TAS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
IBA biological_process
GO:0006955 immune response
TAS biological_process
GO:0007166 cell surface receptor sig
naling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IDA biological_process
GO:0008009 chemokine activity
IDA molecular_function
GO:0030593 neutrophil chemotaxis
IBA biological_process
GO:0031735 CCR10 chemokine receptor
binding
IDA molecular_function
GO:0042379 chemokine receptor bindin
g
IDA molecular_function
GO:0043547 positive regulation of GT
Pase activity
IBA biological_process
GO:0048247 lymphocyte chemotaxis
IBA biological_process
GO:0060326 cell chemotaxis
IDA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IBA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IBA biological_process
GO:0071347 cellular response to inte
rleukin-1
IBA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IBA biological_process
GO:1903237 negative regulation of le
ukocyte tethering or roll
ing
IDA biological_process
GO:0001954 positive regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0002548 monocyte chemotaxis
IBA biological_process
GO:0005125 cytokine activity
IEA molecular_function
GO:0005179 hormone activity
TAS molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
IBA biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
IEA biological_process
GO:0006955 immune response
TAS biological_process
GO:0007166 cell surface receptor sig
naling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IDA biological_process
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
TAS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0030593 neutrophil chemotaxis
IBA biological_process
GO:0031735 CCR10 chemokine receptor
binding
IDA molecular_function
GO:0042379 chemokine receptor bindin
g
IDA molecular_function
GO:0043547 positive regulation of GT
Pase activity
IBA biological_process
GO:0048247 lymphocyte chemotaxis
IBA biological_process
GO:0050900 leukocyte migration
IEA biological_process
GO:0060326 cell chemotaxis
IDA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IBA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IBA biological_process
GO:0071347 cellular response to inte
rleukin-1
IBA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IBA biological_process
GO:1903237 negative regulation of le
ukocyte tethering or roll
ing
IDA biological_process
GO:0001954 positive regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0002548 monocyte chemotaxis
IBA biological_process
GO:0005179 hormone activity
TAS molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006954 inflammatory response
IBA biological_process
GO:0006955 immune response
TAS biological_process
GO:0007166 cell surface receptor sig
naling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IDA biological_process
GO:0008009 chemokine activity
TAS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0030593 neutrophil chemotaxis
IBA biological_process
GO:0031735 CCR10 chemokine receptor
binding
IDA molecular_function
GO:0042379 chemokine receptor bindin
g
IDA molecular_function
GO:0043547 positive regulation of GT
Pase activity
IBA biological_process
GO:0048247 lymphocyte chemotaxis
IBA biological_process
GO:0060326 cell chemotaxis
IDA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IBA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IBA biological_process
GO:0071347 cellular response to inte
rleukin-1
IBA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IBA biological_process
GO:1903237 negative regulation of le
ukocyte tethering or roll
ing
IDA biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production

Diseases

Associated diseases References
Endometriosis PMID: 20081876
Endometriosis INFBASE20081876

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
20081876 Endometrio
sis


CCR9
TECK
Show abstract