Endometriosis Knowledgebase

Search Result

Gene id

6372

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCL6 Gene UCSC Ensembl

Aliases

CKA-3, GCP-2, GCP2, SCYB6

Gene name

C-X-C motif chemokine ligand 6

Alternate names

C-X-C motif chemokine 6, Small inducible cytokine subfamily B (Cys-X-Cys), member b, chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2), chemokine alpha 3, granulocyte chemotactic protein 2, small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2), small-inducible cytokine B6,

Gene location

4q13.3 (73836555: 73838759) Exons: 4 NC_000004.12

OMIM

138965

Protein Summary

Protein general information

P80162

Name: C-X-C motif chemokine 6 (Chemokine alpha 3) (CKA-3) (Granulocyte chemotactic protein 2) (GCP-2) (Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6, N-processed variant 1; Small-inducible cytokine B6, N-processed variant 2; Small-indu

Length: 114 Mass: 11,897

Sequence

MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQC
SKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

Structural information

Interpro:	IPR001089 IPR018048 IPR001811 IPR033899 IPR036048
Prosite:	PS00471
Pfam:	PF00048
CDD:	cd00273
MINT:
STRING:	ENSP00000226317;

Other Databases

GeneCards: CXCL6; Malacards: CXCL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002446	neutrophil mediated immun ity	IBA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0002446	neutrophil mediated immun ity	IBA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IBA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0002446	neutrophil mediated immun ity	IBA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process

KEGG pathways

hsa04657  IL-17 signaling pathway
hsa05323  Rheumatoid arthritis
hsa05133  Pertussis
hsa04062  Chemokine signaling pathway
hsa04060  Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Endometriosis	INFBASE16305697

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16305697	Endometrio sis			64 (38 women wi th endometriosi s, 26 cystadeno mas)		GCP-2	Show abstract