Endometriosis Knowledgebase

Search Result

Gene id

6374

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCL5 Gene UCSC Ensembl

Aliases

ENA-78, SCYB5

Gene name

C-X-C motif chemokine ligand 5

Alternate names

C-X-C motif chemokine 5, chemokine (C-X-C motif) ligand 5, epithelial-derived neutrophil-activating protein 78, neutrophil-activating peptide ENA-78, neutrophil-activating protein 78, small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-deriv,

Gene location

4q13.3 (73998728: 73995641) Exons: 4 NC_000004.12

Gene summary(Entrez)

This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013]

OMIM

600324

Protein Summary

Protein general information

P42830

Name: C X C motif chemokine 5 (ENA 78(1 78)) (Epithelial derived neutrophil activating protein 78) (Neutrophil activating peptide ENA 78) (Small inducible cytokine B5) [Cleaved into: ENA 78(8 78); ENA 78(9 78)]

Length: 114 Mass: 11,972

Sequence

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQC
SKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Structural information

Interpro:	IPR001089 IPR018048 IPR001811 IPR033899
Prosite:	PS00471
Pfam:	PF00048
CDD:	cd00273
PDB:	2MGS
PDBsum:	2MGS
DIP:	5911
STRING:	ENSP00000296027;

Other Databases

GeneCards: CXCL5; Malacards: CXCL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002446	neutrophil mediated immun ity	IBA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0002446	neutrophil mediated immun ity	IBA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IBA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0002446	neutrophil mediated immun ity	IBA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IBA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0045236	CXCR chemokine receptor b inding	IBA	molecular_function
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04668  TNF signaling pathway
hsa04657  IL-17 signaling pathway
hsa05323  Rheumatoid arthritis
hsa05133  Pertussis

Diseases

Associated diseases	References
Cancer	PMID: 17549409
Endometriosis	PMID: 15837658
Endometriosis	INFBASE12620496

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
15837658	Endometrio sis	67 (42 patients with endometri osis (20 in sta ges I and II, 2 2 in stages III and IV), 25 wo men without end ometriosis (con trol group))	ENA-78	Show abstract
14967364	Endometrio sis	59 (35 women wi th endometriosi s, 24 women wit hout endometrio sis)	ENA-78	Show abstract
12620496	Endometrio sis	27 (18 women wi th endometriosi s, 9 women with out endometrios is)	ENA-78	Show abstract
16553183	Endometrio sis	326 (47 women w ith endometrios is, 279 women w ithout endometr iosis)	IL-6 TNF-alpha ENA-78	Show abstract