Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6376
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CX3CL1   Gene   UCSC   Ensembl
Aliases ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Gene name C-X3-C motif chemokine ligand 1
Alternate names fractalkine, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, chemokine (C-X3-C motif) ligand 1, small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin), small inducible cytokine subfamily D (Cys-X3-Cys), member-1, smal,
Gene location 16q21 (57372460: 57385047)     Exons: 3     NC_000016.10
OMIM 601880

Protein Summary

Protein general information P78423  

Name: Fractalkine (C X3 C motif chemokine 1) (CX3C membrane anchored chemokine) (Neurotactin) (Small inducible cytokine D1) [Cleaved into: Processed fractalkine]

Length: 397  Mass: 42,203

Tissue specificity: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart. {ECO

Sequence MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCA
DPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRA
LGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPS
TQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMFTYQSLQGCPRKMAGE
MAEGLRYIPRSCGSNSYVLVPV
Structural information
Interpro:  IPR034127 IPR001811 IPR008097

Pfam:  
PF00048
CDD:   cd00274

PDB:  
1B2T 1F2L 3ONA 4XT1 4XT3
PDBsum:   1B2T 1F2L 3ONA 4XT1 4XT3

DIP:  
5878
STRING:   ENSP00000006053;
Other Databases GeneCards:  CX3CL1;  Malacards:  CX3CL1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001666 response to hypoxia
IEA biological_process
GO:0001774 microglial cell activatio
n
IEA biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
IEA biological_process
GO:0002523 leukocyte migration invol
ved in inflammatory respo
nse
IMP biological_process
GO:0002548 monocyte chemotaxis
IBA biological_process
GO:0005102 receptor binding
TAS molecular_function
GO:0005178 integrin binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IDA cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006935 chemotaxis
IDA biological_process
GO:0006935 chemotaxis
IMP biological_process
GO:0006952 defense response
TAS biological_process
GO:0006955 immune response
TAS biological_process
GO:0007155 cell adhesion
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IBA biological_process
GO:0007568 aging
IEA biological_process
GO:0008009 chemokine activity
TAS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0010759 positive regulation of ma
crophage chemotaxis
IEA biological_process
GO:0016021 integral component of mem
brane
IDA cellular_component
GO:0019221 cytokine-mediated signali
ng pathway
TAS biological_process
GO:0030168 platelet activation
IEA biological_process
GO:0030593 neutrophil chemotaxis
IBA biological_process
GO:0030595 leukocyte chemotaxis
TAS biological_process
GO:0031737 CX3C chemokine receptor b
inding
IDA molecular_function
GO:0032914 positive regulation of tr
ansforming growth factor
beta1 production
IEA biological_process
GO:0033622 integrin activation
IMP biological_process
GO:0042995 cell projection
IEA cellular_component
GO:0043547 positive regulation of GT
Pase activity
IBA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0045906 negative regulation of va
soconstriction
IEA biological_process
GO:0048020 CCR chemokine receptor bi
nding
IBA molecular_function
GO:0048246 macrophage chemotaxis
IEA biological_process
GO:0048247 lymphocyte chemotaxis
IBA biological_process
GO:0048471 perinuclear region of cyt
oplasm
IEA cellular_component
GO:0048661 positive regulation of sm
ooth muscle cell prolifer
ation
IEA biological_process
GO:0050710 negative regulation of cy
tokine secretion
IEA biological_process
GO:0050729 positive regulation of in
flammatory response
IEP biological_process
GO:0050902 leukocyte adhesive activa
tion
TAS biological_process
GO:0051041 positive regulation of ca
lcium-independent cell-ce
ll adhesion
IDA biological_process
GO:0060055 angiogenesis involved in
wound healing
IEA biological_process
GO:0060080 inhibitory postsynaptic p
otential
IEA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IBA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IBA biological_process
GO:0071347 cellular response to inte
rleukin-1
IBA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IBA biological_process
GO:0098794 postsynapse
IEA cellular_component
GO:2001240 negative regulation of ex
trinsic apoptotic signali
ng pathway in absence of
ligand
IEA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0001774 microglial cell activatio
n
IEA biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
IEA biological_process
GO:0002523 leukocyte migration invol
ved in inflammatory respo
nse
IMP biological_process
GO:0002548 monocyte chemotaxis
IBA biological_process
GO:0005102 receptor binding
TAS molecular_function
GO:0005125 cytokine activity
IEA molecular_function
GO:0005178 integrin binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IDA cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
IEA biological_process
GO:0006935 chemotaxis
IDA biological_process
GO:0006935 chemotaxis
IMP biological_process
GO:0006952 defense response
TAS biological_process
GO:0006955 immune response
IEA biological_process
GO:0006955 immune response
TAS biological_process
GO:0007155 cell adhesion
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IBA biological_process
GO:0007568 aging
IEA biological_process
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
TAS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0009986 cell surface
IEA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0010759 positive regulation of ma
crophage chemotaxis
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IDA cellular_component
GO:0019221 cytokine-mediated signali
ng pathway
IEA biological_process
GO:0019221 cytokine-mediated signali
ng pathway
IEA biological_process
GO:0019221 cytokine-mediated signali
ng pathway
TAS biological_process
GO:0030168 platelet activation
IEA biological_process
GO:0030335 positive regulation of ce
ll migration
IEA biological_process
GO:0030593 neutrophil chemotaxis
IEA biological_process
GO:0030593 neutrophil chemotaxis
IBA biological_process
GO:0030595 leukocyte chemotaxis
TAS biological_process
GO:0031737 CX3C chemokine receptor b
inding
IDA molecular_function
GO:0032914 positive regulation of tr
ansforming growth factor
beta1 production
IEA biological_process
GO:0033622 integrin activation
IMP biological_process
GO:0042060 wound healing
IEA biological_process
GO:0042995 cell projection
IEA cellular_component
GO:0043547 positive regulation of GT
Pase activity
IBA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0045785 positive regulation of ce
ll adhesion
IEA biological_process
GO:0045906 negative regulation of va
soconstriction
IEA biological_process
GO:0048020 CCR chemokine receptor bi
nding
IBA molecular_function
GO:0048246 macrophage chemotaxis
IEA biological_process
GO:0048247 lymphocyte chemotaxis
IEA biological_process
GO:0048247 lymphocyte chemotaxis
IBA biological_process
GO:0048471 perinuclear region of cyt
oplasm
IEA cellular_component
GO:0048661 positive regulation of sm
ooth muscle cell prolifer
ation
IEA biological_process
GO:0050710 negative regulation of cy
tokine secretion
IEA biological_process
GO:0050729 positive regulation of in
flammatory response
IEP biological_process
GO:0050902 leukocyte adhesive activa
tion
IEA biological_process
GO:0050902 leukocyte adhesive activa
tion
TAS biological_process
GO:0051041 positive regulation of ca
lcium-independent cell-ce
ll adhesion
IDA biological_process
GO:0060055 angiogenesis involved in
wound healing
IEA biological_process
GO:0060080 inhibitory postsynaptic p
otential
IEA biological_process
GO:0060326 cell chemotaxis
IEA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IBA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IBA biological_process
GO:0071347 cellular response to inte
rleukin-1
IBA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IBA biological_process
GO:0098794 postsynapse
IEA cellular_component
GO:2001240 negative regulation of ex
trinsic apoptotic signali
ng pathway in absence of
ligand
IEA biological_process
GO:0002523 leukocyte migration invol
ved in inflammatory respo
nse
IMP biological_process
GO:0002548 monocyte chemotaxis
IBA biological_process
GO:0005102 receptor binding
TAS molecular_function
GO:0005178 integrin binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IDA cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006935 chemotaxis
IDA biological_process
GO:0006935 chemotaxis
IMP biological_process
GO:0006952 defense response
TAS biological_process
GO:0006955 immune response
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IBA biological_process
GO:0008009 chemokine activity
TAS molecular_function
GO:0008009 chemokine activity
IDA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0016021 integral component of mem
brane
IDA cellular_component
GO:0019221 cytokine-mediated signali
ng pathway
TAS biological_process
GO:0030593 neutrophil chemotaxis
IBA biological_process
GO:0030595 leukocyte chemotaxis
TAS biological_process
GO:0031737 CX3C chemokine receptor b
inding
IDA molecular_function
GO:0033622 integrin activation
IMP biological_process
GO:0043547 positive regulation of GT
Pase activity
IBA biological_process
GO:0048020 CCR chemokine receptor bi
nding
IBA molecular_function
GO:0048247 lymphocyte chemotaxis
IBA biological_process
GO:0050729 positive regulation of in
flammatory response
IEP biological_process
GO:0050902 leukocyte adhesive activa
tion
TAS biological_process
GO:0051041 positive regulation of ca
lcium-independent cell-ce
ll adhesion
IDA biological_process
GO:0070098 chemokine-mediated signal
ing pathway
IBA biological_process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IBA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IBA biological_process
GO:0071347 cellular response to inte
rleukin-1
IBA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IBA biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04668  TNF signaling pathway

Diseases

Associated diseases References
Asthenozoospermia PMID: 12042278
Asthma PMID: 17505143
Cancer PMID: 17611763
Endometriosis PMID: 23517860
Psoriasis PMID: 17002687
Endometriosis INFBASE16109418

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23517860 Endometrio
sis

64 (22 bowel en
dometriosis, 10
retrocervical
endometriosis,
32 endometriosi
s-free women)
CXCL9
CXCL10
CXCL11
CXCL12
XCL1
CCL17
CCL21and CX3CL1
Show abstract
16109418 Endometrio
sis


Fractalkine
Show abstract