Endometriosis Knowledgebase

Search Result

Gene id

6376

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CX3CL1 Gene UCSC Ensembl

Aliases

ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin

Gene name

C-X3-C motif chemokine ligand 1

Alternate names

fractalkine, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, chemokine (C-X3-C motif) ligand 1, small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin), small inducible cytokine subfamily D (Cys-X3-Cys), member-1, smal,

Gene location

16q21 (57372460: 57385047) Exons: 3 NC_000016.10

OMIM

601880

Protein Summary

Protein general information

P78423

Name: Fractalkine (C X3 C motif chemokine 1) (CX3C membrane anchored chemokine) (Neurotactin) (Small inducible cytokine D1) [Cleaved into: Processed fractalkine]

Length: 397 Mass: 42,203

Tissue specificity: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas. Most abundant in the brain and heart. {ECO

Sequence

MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCA
DPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRA
LGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPS
TQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMFTYQSLQGCPRKMAGE
MAEGLRYIPRSCGSNSYVLVPV

Structural information

Interpro:	IPR034127 IPR001811 IPR008097
Pfam:	PF00048
CDD:	cd00274
PDB:	1B2T 1F2L 3ONA 4XT1 4XT3
PDBsum:	1B2T 1F2L 3ONA 4XT1 4XT3
DIP:	5878
STRING:	ENSP00000006053;

Other Databases

GeneCards: CX3CL1; Malacards: CX3CL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001774	microglial cell activatio n	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	IMP	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IDA	biological_process
GO:0006935	chemotaxis	IMP	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0010759	positive regulation of ma crophage chemotaxis	IEA	biological_process
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	TAS	biological_process
GO:0030168	platelet activation	IEA	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0030595	leukocyte chemotaxis	TAS	biological_process
GO:0031737	CX3C chemokine receptor b inding	IDA	molecular_function
GO:0032914	positive regulation of tr ansforming growth factor beta1 production	IEA	biological_process
GO:0033622	integrin activation	IMP	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045906	negative regulation of va soconstriction	IEA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048246	macrophage chemotaxis	IEA	biological_process
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050710	negative regulation of cy tokine secretion	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEP	biological_process
GO:0050902	leukocyte adhesive activa tion	TAS	biological_process
GO:0051041	positive regulation of ca lcium-independent cell-ce ll adhesion	IDA	biological_process
GO:0060055	angiogenesis involved in wound healing	IEA	biological_process
GO:0060080	inhibitory postsynaptic p otential	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0098794	postsynapse	IEA	cellular_component
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001774	microglial cell activatio n	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	IMP	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IDA	biological_process
GO:0006935	chemotaxis	IMP	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010759	positive regulation of ma crophage chemotaxis	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	TAS	biological_process
GO:0030168	platelet activation	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030593	neutrophil chemotaxis	IEA	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0030595	leukocyte chemotaxis	TAS	biological_process
GO:0031737	CX3C chemokine receptor b inding	IDA	molecular_function
GO:0032914	positive regulation of tr ansforming growth factor beta1 production	IEA	biological_process
GO:0033622	integrin activation	IMP	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IEA	biological_process
GO:0045906	negative regulation of va soconstriction	IEA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048246	macrophage chemotaxis	IEA	biological_process
GO:0048247	lymphocyte chemotaxis	IEA	biological_process
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050710	negative regulation of cy tokine secretion	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEP	biological_process
GO:0050902	leukocyte adhesive activa tion	IEA	biological_process
GO:0050902	leukocyte adhesive activa tion	TAS	biological_process
GO:0051041	positive regulation of ca lcium-independent cell-ce ll adhesion	IDA	biological_process
GO:0060055	angiogenesis involved in wound healing	IEA	biological_process
GO:0060080	inhibitory postsynaptic p otential	IEA	biological_process
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process
GO:0098794	postsynapse	IEA	cellular_component
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IEA	biological_process
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	IMP	biological_process
GO:0002548	monocyte chemotaxis	IBA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IDA	biological_process
GO:0006935	chemotaxis	IMP	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IBA	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0016021	integral component of mem brane	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	TAS	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0030595	leukocyte chemotaxis	TAS	biological_process
GO:0031737	CX3C chemokine receptor b inding	IDA	molecular_function
GO:0033622	integrin activation	IMP	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0048020	CCR chemokine receptor bi nding	IBA	molecular_function
GO:0048247	lymphocyte chemotaxis	IBA	biological_process
GO:0050729	positive regulation of in flammatory response	IEP	biological_process
GO:0050902	leukocyte adhesive activa tion	TAS	biological_process
GO:0051041	positive regulation of ca lcium-independent cell-ce ll adhesion	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IBA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IBA	biological_process
GO:0071347	cellular response to inte rleukin-1	IBA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IBA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04668  TNF signaling pathway

Diseases

Associated diseases	References
Asthenozoospermia	PMID: 12042278
Asthma	PMID: 17505143
Cancer	PMID: 17611763
Endometriosis	PMID: 23517860
Psoriasis	PMID: 17002687
Endometriosis	INFBASE16109418

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23517860	Endometrio sis			64 (22 bowel en dometriosis, 10 retrocervical endometriosis, 32 endometriosi s-free women)		CXCL9 CXCL10 CXCL11 CXCL12 XCL1 CCL17 CCL21and CX3CL1	Show abstract
16109418	Endometrio sis					Fractalkine	Show abstract