Endometriosis Knowledgebase

Search Result

Gene id

6385

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SDC4 Gene UCSC Ensembl

Aliases

SYND4

Gene name

syndecan 4

Alternate names

syndecan-4, amphiglycan, ryudocan amphiglycan, ryudocan core protein, syndecan 4 (amphiglycan, ryudocan), syndecan proteoglycan 4,

Gene location

20q13.12 (45348423: 45325287) Exons: 5 NC_000020.11

Gene summary(Entrez)

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22. [provided by RefSeq, Jul 2008]

OMIM

600017

Protein Summary

Protein general information

P31431

Name: Syndecan-4 (SYND4) (Amphiglycan) (Ryudocan core protein)

Length: 198 Mass: 21,642

Tissue specificity: Expressed in epithelial and fibroblastic cells. {ECO

Sequence

MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIG
PEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAAL
IVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

Structural information

Interpro:	IPR003585 IPR001050 IPR027789 IPR030479
Prosite:	PS00964
Pfam:	PF01034
PDB:	1EJP 1EJQ 1OBY 1YBO
PDBsum:	1EJP 1EJQ 1OBY 1YBO
DIP:	29945
MINT:
STRING:	ENSP00000361818;

Other Databases

GeneCards: SDC4; Malacards: SDC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001843	neural tube closure	IEA	biological_process
GO:0001968	fibronectin binding	IEA	molecular_function
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0006024	glycosaminoglycan biosynt hetic process	TAS	biological_process
GO:0006027	glycosaminoglycan catabol ic process	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0009986	cell surface	IBA	cellular_component
GO:0010762	regulation of fibroblast migration	IEA	biological_process
GO:0016477	cell migration	IBA	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0043034	costamere	IEA	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0045121	membrane raft	IEA	cellular_component
GO:0045860	positive regulation of pr otein kinase activity	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IEA	biological_process
GO:0060122	inner ear receptor stereo cilium organization	IEA	biological_process
GO:0070053	thrombospondin receptor a ctivity	IMP	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1903543	positive regulation of ex osomal secretion	IMP	biological_process
GO:1903553	positive regulation of ex tracellular exosome assem bly	IMP	biological_process
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001843	neural tube closure	IEA	biological_process
GO:0001968	fibronectin binding	IEA	molecular_function
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0006024	glycosaminoglycan biosynt hetic process	TAS	biological_process
GO:0006027	glycosaminoglycan catabol ic process	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IBA	cellular_component
GO:0010762	regulation of fibroblast migration	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016477	cell migration	IBA	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0043034	costamere	IEA	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0045121	membrane raft	IEA	cellular_component
GO:0045860	positive regulation of pr otein kinase activity	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IEA	biological_process
GO:0060122	inner ear receptor stereo cilium organization	IEA	biological_process
GO:0070053	thrombospondin receptor a ctivity	IMP	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1903543	positive regulation of ex osomal secretion	IMP	biological_process
GO:1903553	positive regulation of ex tracellular exosome assem bly	IMP	biological_process
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0006024	glycosaminoglycan biosynt hetic process	TAS	biological_process
GO:0006027	glycosaminoglycan catabol ic process	TAS	biological_process
GO:0009986	cell surface	IBA	cellular_component
GO:0016477	cell migration	IBA	biological_process
GO:0030203	glycosaminoglycan metabol ic process	TAS	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0070053	thrombospondin receptor a ctivity	IMP	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1903543	positive regulation of ex osomal secretion	IMP	biological_process
GO:1903553	positive regulation of ex tracellular exosome assem bly	IMP	biological_process

KEGG pathways

hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa05418  Fluid shear stress and atherosclerosis
hsa05205  Proteoglycans in cancer

Diseases

Associated diseases	References
Endometriosis	INFBASE27041028

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27041028	Endometrio sis			106 (62 control s, 44 endometri osis)		Rac1 MMP3 ATF-2 SDC4	Show abstract