Endometriosis Knowledgebase

Search Result

Gene id

639

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PRDM1 Gene UCSC Ensembl

Aliases

BLIMP1, PRDI-BF1

Gene name

PR/SET domain 1

Alternate names

PR domain zinc finger protein 1, B-lymphocyte-induced maturation protein 1, BLIMP-1, PR domain 1, PR domain containing 1, with ZNF domain, PRDI-binding factor-1, beta-interferon gene positive-regulatory domain I binding factor,

Gene location

6q21 (106046728: 106109938) Exons: 11 NC_000006.12

Gene summary(Entrez)

This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq, Jul 2008]

OMIM

603423

Protein Summary

Protein general information

O75626

Name: PR domain zinc finger protein 1 (EC 2.1.1. ) (BLIMP 1) (Beta interferon gene positive regulatory domain I binding factor) (PR domain containing protein 1) (Positive regulatory domain I binding factor 1) (PRDI BF1) (PRDI binding factor 1)

Length: 825 Mass: 91,771

Sequence

MLDICLEKRVGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGT
SVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDG
FNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQTQ
SSLKQPSTEKNELCPKNVPKREYSVKEILKLDSNPSKGKDLYRSNISPLTSEKDLDDFRRRGSPEMPFYPRVVYP
IRAPLPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVGPGSQEHRDSYA
YLNASYGTEGLGSYPGYAPLPHLPPAFIPSYNAHYPKFLLPPYGMNCNGLSAVSSMNGINNFGLFPRLCPVYSNL
LGGGSLPHPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATA
EHVVQPKATSAAMAAPSSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGE
RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLK
LHKRLHTRERPHKCSQCHKNYIHLCSLKVHLKGNCAAAPAPGLPLEDLTRINEEIEKFDISDNADRLEDVEDDIS
VISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYESSDLPLMKLPPSNPLPLVPVKVKQETVEPMDP

Structural information

Protein Domains	SET. (84-201)
Interpro:	IPR016608 IPR001214 IPR013087
Prosite:	PS50280 PS00028 PS50157
Pfam:	PF00856
PDB:	3DAL
PDBsum:	3DAL
MINT:	2857156
STRING:	ENSP00000358092;

Other Databases

GeneCards: PRDM1; Malacards: PRDM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001763	morphogenesis of a branch ing structure	IEA	biological_process
GO:0001893	maternal placenta develop ment	IEA	biological_process
GO:0003170	heart valve development	IEA	biological_process
GO:0003281	ventricular septum develo pment	IEA	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0008168	methyltransferase activit y	IEA	molecular_function
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0030889	negative regulation of B cell proliferation	IEA	biological_process
GO:0031665	negative regulation of li popolysaccharide-mediated signaling pathway	IEA	biological_process
GO:0032259	methylation	IEA	biological_process
GO:0035904	aorta development	IEA	biological_process
GO:0042462	eye photoreceptor cell de velopment	IEA	biological_process
GO:0042826	histone deacetylase bindi ng	IEA	molecular_function
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045579	positive regulation of B cell differentiation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048844	artery morphogenesis	IEA	biological_process
GO:0060576	intestinal epithelial cel l development	IEA	biological_process
GO:0060707	trophoblast giant cell di fferentiation	IEA	biological_process
GO:0060976	coronary vasculature deve lopment	IEA	biological_process
GO:1990654	sebum secreting cell prol iferation	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001763	morphogenesis of a branch ing structure	IEA	biological_process
GO:0001892	embryonic placenta develo pment	IEA	biological_process
GO:0001893	maternal placenta develop ment	IEA	biological_process
GO:0003170	heart valve development	IEA	biological_process
GO:0003279	cardiac septum developmen t	IEA	biological_process
GO:0003281	ventricular septum develo pment	IEA	biological_process
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0008168	methyltransferase activit y	IEA	molecular_function
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0030889	negative regulation of B cell proliferation	IEA	biological_process
GO:0031665	negative regulation of li popolysaccharide-mediated signaling pathway	IEA	biological_process
GO:0032259	methylation	IEA	biological_process
GO:0035904	aorta development	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042462	eye photoreceptor cell de velopment	IEA	biological_process
GO:0042826	histone deacetylase bindi ng	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045579	positive regulation of B cell differentiation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048844	artery morphogenesis	IEA	biological_process
GO:0048869	cellular developmental pr ocess	IEA	biological_process
GO:0060576	intestinal epithelial cel l development	IEA	biological_process
GO:0060707	trophoblast giant cell di fferentiation	IEA	biological_process
GO:0060976	coronary vasculature deve lopment	IEA	biological_process
GO:1990654	sebum secreting cell prol iferation	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 26054109
Endometriosis	INFBASE26054109
Rheumatoid arthritis	PMID: 19898481
Systemic lupus erythematosus	PMID: 19838195

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26054109	Endometrio sis			98 (46 with end ometriosis, 52 with benign tum ors)		IL-1 TNF IgG IgA Bcl-6 Blimp-1	Show abstract