Endometriosis Knowledgebase

Search Result

Gene id

6401

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SELE Gene UCSC Ensembl

Aliases

CD62E, ELAM, ELAM1, ESEL, LECAM2

Gene name

selectin E

Alternate names

E-selectin, CD62 antigen-like family member E, ELAM-1, endothelial adhesion molecule 1, endothelial leukocyte adhesion molecule 1, leukocyte endothelial cell adhesion molecule 2,

Gene location

1q24.2 (169734078: 169722639) Exons: 14 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]

OMIM

131210

Protein Summary

Protein general information

P16581

Name: E selectin (CD62 antigen like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM 1) (Leukocyte endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)

Length: 610 Mass: 66,655

Sequence

MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIR
KVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSG
HGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCM
SSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPER
GYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGE
FTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWT
LNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL

Structural information

Protein Domains	C-type (22-139) EGF-like. (140-175) Sushi (178-239) Sushi (240-301)
Interpro:	IPR001304 IPR016186 IPR018378 IPR016187 IPR013032 IPR000742 IPR033991 IPR002396 IPR000436
Prosite:	PS00615 PS50041 PS00022 PS01186 PS50026 PS50923
Pfam:	PF00008 PF00059 PF00084
CDD:	cd00033 cd03592
PDB:	1ESL 1G1T 1KJA 4C16 4CSY
PDBsum:	1ESL 1G1T 1KJA 4C16 4CSY
DIP:	58639
MINT:	8020220
STRING:	ENSP00000331736;

Other Databases

GeneCards: SELE; Malacards: SELE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002092	positive regulation of re ceptor internalization	IDA	biological_process
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	TAS	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0005905	clathrin-coated pit	IDA	cellular_component
GO:0006954	inflammatory response	TAS	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IMP	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007202	activation of phospholipa se C activity	IMP	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019722	calcium-mediated signalin g	TAS	biological_process
GO:0030029	actin filament-based proc ess	IDA	biological_process
GO:0030863	cortical cytoskeleton	IDA	cellular_component
GO:0032496	response to lipopolysacch aride	TAS	biological_process
GO:0033691	sialic acid binding	IDA	molecular_function
GO:0034612	response to tumor necrosi s factor	TAS	biological_process
GO:0043274	phospholipase binding	IDA	molecular_function
GO:0045121	membrane raft	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050727	regulation of inflammator y response	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050901	leukocyte tethering or ro lling	IMP	biological_process
GO:0070492	oligosaccharide binding	IDA	molecular_function
GO:0070555	response to interleukin-1	IDA	biological_process
GO:0002092	positive regulation of re ceptor internalization	IDA	biological_process
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	TAS	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0005905	clathrin-coated pit	IDA	cellular_component
GO:0006954	inflammatory response	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IMP	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007202	activation of phospholipa se C activity	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019722	calcium-mediated signalin g	TAS	biological_process
GO:0030029	actin filament-based proc ess	IDA	biological_process
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0030863	cortical cytoskeleton	IDA	cellular_component
GO:0032496	response to lipopolysacch aride	TAS	biological_process
GO:0033691	sialic acid binding	IDA	molecular_function
GO:0034612	response to tumor necrosi s factor	TAS	biological_process
GO:0043274	phospholipase binding	IDA	molecular_function
GO:0045121	membrane raft	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050727	regulation of inflammator y response	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050901	leukocyte tethering or ro lling	IMP	biological_process
GO:0070492	oligosaccharide binding	IDA	molecular_function
GO:0070555	response to interleukin-1	IDA	biological_process
GO:0002092	positive regulation of re ceptor internalization	IDA	biological_process
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	TAS	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0005905	clathrin-coated pit	IDA	cellular_component
GO:0006954	inflammatory response	TAS	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IMP	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007202	activation of phospholipa se C activity	IMP	biological_process
GO:0019722	calcium-mediated signalin g	TAS	biological_process
GO:0030029	actin filament-based proc ess	IDA	biological_process
GO:0030863	cortical cytoskeleton	IDA	cellular_component
GO:0032496	response to lipopolysacch aride	TAS	biological_process
GO:0033691	sialic acid binding	IDA	molecular_function
GO:0034612	response to tumor necrosi s factor	TAS	biological_process
GO:0043274	phospholipase binding	IDA	molecular_function
GO:0045121	membrane raft	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050727	regulation of inflammator y response	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050901	leukocyte tethering or ro lling	IMP	biological_process
GO:0070492	oligosaccharide binding	IDA	molecular_function
GO:0070555	response to interleukin-1	IDA	biological_process

KEGG pathways

hsa05418  Fluid shear stress and atherosclerosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04668  TNF signaling pathway
hsa04514  Cell adhesion molecules
hsa05144  Malaria
hsa05143  African trypanosomiasis

Diseases

Associated diseases	References
Asthma	PMID: 17563404
Autoimmune thyroid disease (AITD)	PMID: 15584003
Cancer	PMID: 17372905
Celiac disease	PMID: 16916660
Cerebrovascular disease	PMID: 12871600
Chronic kidney failure	PMID: 16974056
Diabetes	PMID: 15833936
Diabetic retinopathy	PMID: 12027924
Endometriosis	PMID: 10836198
Graves disease	PMID: 18094708
Limb deficiency defects	PMID: 17036337
Macular degeneration	PMID: 17057786
Metabolism disorders	PMID: 14557872
Multiple sclerosis	PMID: 15979159
Endometriosis	INFBASE10224799
Nephropathy	PMID: 11828340
Ovarian hyperstimulation syndrome (OHSS)	PMID: 16028375
Preeclampsia	PMID: 17939599
Rheumatoid arthritis	PMID: 17014013
Sarcoidosis	PMID: 15083893
Systemic lupus erythematosus	PMID: 11764211

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
10224799	Endometrio sis					ICAM-1 E-Selectin	Show abstract
27433816	Endometrio sis			30 (22 patients , 8 healthy wom en)			Show abstract