Endometriosis Knowledgebase

Search Result

Gene id

64127

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NOD2 Gene UCSC Ensembl

Aliases

ACUG, BLAU, BLAUS, CARD15, CD, CLR16.3, IBD1, NLRC2, NOD2B, PSORAS1, YAOS

Gene name

nucleotide binding oligomerization domain containing 2

Alternate names

nucleotide-binding oligomerization domain-containing protein 2, NLR family, CARD domain containing 2, NOD-like receptor C2, caspase recruitment domain family, member 15, caspase recruitment domain protein 15, caspase recruitment domain-containing protein 15, in,

Gene location

16q12.1 (50693580: 50733076) Exons: 17 NC_000016.10

Gene summary(Entrez)

This gene is a member of the Nod1/Apaf-1 family and encodes a protein with two caspase recruitment (CARD) domains and six leucine-rich repeats (LRRs). The protein is primarily expressed in the peripheral blood leukocytes. It plays a role in the immune response to intracellular bacterial lipopolysaccharides (LPS) by recognizing the muramyl dipeptide (MDP) derived from them and activating the NFKB protein. Mutations in this gene have been associated with Crohn disease and Blau syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

OMIM

605956

Protein Summary

Protein general information

Q9HC29

Name: Nucleotide binding oligomerization domain containing protein 2 (Caspase recruitment domain containing protein 15) (Inflammatory bowel disease protein 1)

Length: 1040 Mass: 115,283

Tissue specificity: Expressed in intestinal mucosa, mainly in Paneth cells and, at lower extent, in the glandular epithelium. {ECO

Sequence

MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFH
LLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVE
NMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAK
LRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE
AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQEDIFQLLLDHPDRVL
LTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNARKVVTSRPAAVSAFLRKYIRTEFNLKGFSEQ
GIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHA
TPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE
FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITA
AFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQ
EERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDN
NISDRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS
LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSL
AEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL

Structural information

Protein Domains	CARD (26-122) CARD (126-218) NACHT. (293-618)
Motifs	ATG16L1-binding motif.(63-77)
Interpro:	IPR001315 IPR011029 IPR032675 IPR001611 IPR007111 IPR027417
Prosite:	PS50209 PS51450 PS50837
Pfam:	PF00619 PF13516
DIP:	41998
MINT:	151071
STRING:	ENSP00000300589;

Other Databases

GeneCards: NOD2; Malacards: NOD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0002367	cytokine production invol ved in immune response	IMP	biological_process
GO:0002374	cytokine secretion involv ed in immune response	IMP	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	ISS	biological_process
GO:0002830	positive regulation of ty pe 2 immune response	IMP	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0009595	detection of biotic stimu lus	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016045	detection of bacterium	IDA	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030277	maintenance of gastrointe stinal epithelium	IMP	biological_process
GO:0030544	Hsp70 protein binding	IPI	molecular_function
GO:0031982	vesicle	IDA	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0032495	response to muramyl dipep tide	IDA	biological_process
GO:0032495	response to muramyl dipep tide	IDA	biological_process
GO:0032495	response to muramyl dipep tide	IMP	biological_process
GO:0032498	detection of muramyl dipe ptide	IDA	biological_process
GO:0032498	detection of muramyl dipe ptide	IDA	biological_process
GO:0032500	muramyl dipeptide binding	IDA	molecular_function
GO:0032731	positive regulation of in terleukin-1 beta producti on	IMP	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IMP	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IMP	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IMP	biological_process
GO:0032874	positive regulation of st ress-activated MAPK casca de	IDA	biological_process
GO:0035419	activation of MAPK activi ty involved in innate imm une response	ISS	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0042742	defense response to bacte rium	IDA	biological_process
GO:0042834	peptidoglycan binding	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	ISS	biological_process
GO:0045087	innate immune response	NAS	biological_process
GO:0045087	innate immune response	IDA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0046645	positive regulation of ga mma-delta T cell activati on	ISS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	ISS	biological_process
GO:0050700	CARD domain binding	IPI	molecular_function
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IDA	biological_process
GO:0050727	regulation of inflammator y response	IC	biological_process
GO:0050871	positive regulation of B cell activation	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051259	protein oligomerization	TAS	biological_process
GO:0051353	positive regulation of ox idoreductase activity	ISS	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0051879	Hsp90 protein binding	IDA	molecular_function
GO:0060585	positive regulation of pr ostaglandin-endoperoxide synthase activity	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070423	nucleotide-binding oligom erization domain containi ng signaling pathway	TAS	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0071225	cellular response to mura myl dipeptide	IDA	biological_process
GO:0071225	cellular response to mura myl dipeptide	IMP	biological_process
GO:1900017	positive regulation of cy tokine production involve d in inflammatory respons e	IDA	biological_process
GO:1901224	positive regulation of NI K/NF-kappaB signaling	IMP	biological_process
GO:2000110	negative regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000363	positive regulation of pr ostaglandin-E synthase ac tivity	ISS	biological_process
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0002367	cytokine production invol ved in immune response	IMP	biological_process
GO:0002374	cytokine secretion involv ed in immune response	IMP	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	ISS	biological_process
GO:0002830	positive regulation of ty pe 2 immune response	IMP	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0009595	detection of biotic stimu lus	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016045	detection of bacterium	IDA	biological_process
GO:0016323	basolateral plasma membra ne	IEA	cellular_component
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030277	maintenance of gastrointe stinal epithelium	IMP	biological_process
GO:0030544	Hsp70 protein binding	IPI	molecular_function
GO:0031982	vesicle	IDA	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0032495	response to muramyl dipep tide	IEA	biological_process
GO:0032495	response to muramyl dipep tide	IDA	biological_process
GO:0032495	response to muramyl dipep tide	IDA	biological_process
GO:0032495	response to muramyl dipep tide	IMP	biological_process
GO:0032498	detection of muramyl dipe ptide	IDA	biological_process
GO:0032498	detection of muramyl dipe ptide	IDA	biological_process
GO:0032500	muramyl dipeptide binding	IDA	molecular_function
GO:0032731	positive regulation of in terleukin-1 beta producti on	IMP	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IMP	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IMP	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IMP	biological_process
GO:0032874	positive regulation of st ress-activated MAPK casca de	IDA	biological_process
GO:0035419	activation of MAPK activi ty involved in innate imm une response	ISS	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0042742	defense response to bacte rium	IDA	biological_process
GO:0042834	peptidoglycan binding	IDA	molecular_function
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	ISS	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	NAS	biological_process
GO:0045087	innate immune response	IDA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0046645	positive regulation of ga mma-delta T cell activati on	ISS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	ISS	biological_process
GO:0050700	CARD domain binding	IPI	molecular_function
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IEA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IDA	biological_process
GO:0050727	regulation of inflammator y response	IC	biological_process
GO:0050871	positive regulation of B cell activation	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051259	protein oligomerization	TAS	biological_process
GO:0051353	positive regulation of ox idoreductase activity	ISS	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0051879	Hsp90 protein binding	IDA	molecular_function
GO:0060585	positive regulation of pr ostaglandin-endoperoxide synthase activity	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070423	nucleotide-binding oligom erization domain containi ng signaling pathway	TAS	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0071225	cellular response to mura myl dipeptide	IDA	biological_process
GO:0071225	cellular response to mura myl dipeptide	IMP	biological_process
GO:1900017	positive regulation of cy tokine production involve d in inflammatory respons e	IDA	biological_process
GO:1901224	positive regulation of NI K/NF-kappaB signaling	IMP	biological_process
GO:2000110	negative regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000363	positive regulation of pr ostaglandin-E synthase ac tivity	ISS	biological_process
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0002367	cytokine production invol ved in immune response	IMP	biological_process
GO:0002374	cytokine secretion involv ed in immune response	IMP	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	ISS	biological_process
GO:0002830	positive regulation of ty pe 2 immune response	IMP	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006952	defense response	TAS	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0009595	detection of biotic stimu lus	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016045	detection of bacterium	IDA	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030277	maintenance of gastrointe stinal epithelium	IMP	biological_process
GO:0030544	Hsp70 protein binding	IPI	molecular_function
GO:0031982	vesicle	IDA	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0032495	response to muramyl dipep tide	IDA	biological_process
GO:0032495	response to muramyl dipep tide	IDA	biological_process
GO:0032495	response to muramyl dipep tide	IMP	biological_process
GO:0032498	detection of muramyl dipe ptide	IDA	biological_process
GO:0032498	detection of muramyl dipe ptide	IDA	biological_process
GO:0032500	muramyl dipeptide binding	IDA	molecular_function
GO:0032731	positive regulation of in terleukin-1 beta producti on	IMP	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IMP	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IMP	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IMP	biological_process
GO:0032874	positive regulation of st ress-activated MAPK casca de	IDA	biological_process
GO:0035419	activation of MAPK activi ty involved in innate imm une response	ISS	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0042742	defense response to bacte rium	IDA	biological_process
GO:0042834	peptidoglycan binding	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	ISS	biological_process
GO:0045087	innate immune response	NAS	biological_process
GO:0045087	innate immune response	IDA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0046645	positive regulation of ga mma-delta T cell activati on	ISS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	ISS	biological_process
GO:0050700	CARD domain binding	IPI	molecular_function
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IDA	biological_process
GO:0050727	regulation of inflammator y response	IC	biological_process
GO:0050871	positive regulation of B cell activation	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051259	protein oligomerization	TAS	biological_process
GO:0051353	positive regulation of ox idoreductase activity	ISS	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0051879	Hsp90 protein binding	IDA	molecular_function
GO:0060585	positive regulation of pr ostaglandin-endoperoxide synthase activity	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070423	nucleotide-binding oligom erization domain containi ng signaling pathway	TAS	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0070431	nucleotide-binding oligom erization domain containi ng 2 signaling pathway	IDA	biological_process
GO:0071225	cellular response to mura myl dipeptide	IDA	biological_process
GO:0071225	cellular response to mura myl dipeptide	IMP	biological_process
GO:1900017	positive regulation of cy tokine production involve d in inflammatory respons e	IDA	biological_process
GO:1901224	positive regulation of NI K/NF-kappaB signaling	IMP	biological_process
GO:2000110	negative regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000363	positive regulation of pr ostaglandin-E synthase ac tivity	ISS	biological_process
GO:0008180	COP9 signalosome	IDA	cellular_component

KEGG pathways

hsa05152  Tuberculosis
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05321  Inflammatory bowel disease
hsa05131  Shigellosis

Diseases

Associated diseases	References
Acute lymphocytic leukemia	PMID: 17724347
Asthma	PMID: 16008671
Atherosclerosis	PMID: 16315780
Atopic dermatitis	KEGG: H01358
Behcet's disease	PMID: 16134731
Blau syndrome	KEGG: H00285
Celiac disease	PMID: 19240061
Cholangitis	PMID: 17100974
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Colitis	PMID: 16804670
Crohn's disease	KEGG: H00286, OMIM: 605956
Dermatitis	PMID: 17620097
Endometriosis	PMID: 23935397
HELLP Syndrome	PMID: 18382655
Hematologic diseases	PMID: 16424393
Hemochromatosis	PMID: 19809335
Hypersensitivity	PMID: 12704363
Inflammatory bowel disease	KEGG: H01227
Multiple sclerosis	PMID: 18563468
Endometriosis	INFBASE23935397
Parkinson's disease	PMID: 17174426
Periodontitis	PMID: 15367194
Premature birth	PMID: 19527514
Psoriasis	OMIM: 605956
Rheumatoid arthritis	PMID: 12595627
SAPHO syndrome	PMID: 20032092
Sarcoidosis	PMID: 16933467
Spondylarthritis	PMID: 12115195
Systemic lupus erythematosus	PMID: 12649405
Uveitis	PMID: 19822951
Wegener granulomatosis	PMID: 12563685
Yao syndrome	OMIM: 605956

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23935397	Endometrio sis			80 (40 patients with endometri osis, 40 withou t endometriosis )		TLR-2 TLR -9 NOD-1 NOD-2 and NOS	Show abstract