Endometriosis Knowledgebase

Search Result

Gene id

6418

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SET Gene UCSC Ensembl

Aliases

2PP2A, I2PP2A, IGAAD, IPP2A2, PHAPII, TAF-I, TAF-IBETA

Gene name

SET nuclear proto-oncogene

Alternate names

protein SET, HLA-DR-associated protein II, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), Template-Activating Factor-I, chromatin remodelling factor, inhibitor of granzyme A-activated DNase, inhibitor-2 of protein phosphatase-2A, phosphat,

Gene location

9q34.11 (128683431: 128696395) Exons: 12 NC_000009.12

Gene summary(Entrez)

The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

OMIM

600960

Protein Summary

Protein general information

Q01105

Name: Protein SET (HLA DR associated protein II) (Inhibitor of granzyme A activated DNase) (IGAAD) (PHAPII) (Phosphatase 2A inhibitor I2PP2A) (I 2PP2A) (Template activating factor I) (TAF I)

Length: 290 Mass: 33,489

Tissue specificity: Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms' tumor.

Sequence

MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNK
LRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENK
VLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDI
WPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

Structural information

Interpro:	IPR002164
Pfam:	PF00956
PDB:	2E50
PDBsum:	2E50
DIP:	33561
MINT:	4990855
STRING:	ENSP00000361777;

Other Databases

GeneCards: SET; Malacards: SET

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular_function
GO:0004864	protein phosphatase inhib itor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006334	nucleosome assembly	IEA	biological_process
GO:0006337	nucleosome disassembly	TAS	biological_process
GO:0006913	nucleocytoplasmic transpo rt	NAS	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0034047	regulation of protein pho sphatase type 2A activity	IEA	biological_process
GO:0035067	negative regulation of hi stone acetylation	TAS	biological_process
GO:0042393	histone binding	TAS	molecular_function
GO:0043086	negative regulation of ca talytic activity	IEA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IGI	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0003677	DNA binding	IEA	molecular_function
GO:0004864	protein phosphatase inhib itor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006334	nucleosome assembly	IEA	biological_process
GO:0006334	nucleosome assembly	TAS	biological_process
GO:0006337	nucleosome disassembly	TAS	biological_process
GO:0006913	nucleocytoplasmic transpo rt	NAS	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0034047	regulation of protein pho sphatase type 2A activity	IEA	biological_process
GO:0035067	negative regulation of hi stone acetylation	TAS	biological_process
GO:0042393	histone binding	TAS	molecular_function
GO:0043086	negative regulation of ca talytic activity	IEA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IGI	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0004864	protein phosphatase inhib itor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006334	nucleosome assembly	TAS	biological_process
GO:0006337	nucleosome disassembly	TAS	biological_process
GO:0006913	nucleocytoplasmic transpo rt	NAS	biological_process
GO:0035067	negative regulation of hi stone acetylation	TAS	biological_process
GO:0042393	histone binding	TAS	molecular_function
GO:0043234	protein complex	IDA	cellular_component
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IGI	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 16249290
Endometriosis	INFBASE16249290

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16249290	Endometrio sis			30 (15 patients undergoing lap aroscopy or hys terectomy for e ndometriosis, 1 5 controls)		IGFBP5 PIM2 RPL41 PSAP FBLN1 SIPL DLX5 HSD11B2 SET and RHOE	Show abstract