Endometriosis Knowledgebase

Search Result

Gene id

6446

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SGK1 Gene UCSC Ensembl

Aliases

SGK

Gene name

serum/glucocorticoid regulated kinase 1

Alternate names

serine/threonine-protein kinase Sgk1, Sgk1 variant i3, serine/threonine protein kinase SGK,

Gene location

6q23.2 (134318111: 134169245) Exons: 18 NC_000006.12

Gene summary(Entrez)

This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009]

OMIM

602958

Protein Summary

Protein general information

O00141

Name: Serine/threonine-protein kinase Sgk1 (EC 2.7.11.1) (Serum/glucocorticoid-regulated kinase 1)

Length: 431 Mass: 48,942

Tissue specificity: Expressed in most tissues with highest levels in the pancreas, followed by placenta, kidney and lung. Isoform 2 is strongly expressed in brain and pancreas, weaker in heart, placenta, lung, liver and skeletal muscle. {ECO

Sequence

MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSP
PPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVL
LKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKP
ENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPN
VSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL

Structural information

Protein Domains	Protein (98-355) AGC-kinase (356-431)
Motifs	Nuclear localization(131-141)
Interpro:	IPR000961 IPR011009 IPR017892 IPR000719 IPR017441 IPR008271
Prosite:	PS51285 PS00107 PS50011 PS00108
Pfam:	PF00069 PF00433
PDB:	2R5T 3HDM 3HDN
PDBsum:	2R5T 3HDM 3HDN
DIP:	42464
MINT:
STRING:	ENSP00000356832;

Other Databases

GeneCards: SGK1; Malacards: SGK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001558	regulation of cell growth	TAS	biological_process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004712	protein serine/threonine/ tyrosine kinase activity	IDA	molecular_function
GO:0005246	calcium channel regulator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006814	sodium ion transport	TAS	biological_process
GO:0006883	cellular sodium ion homeo stasis	IBA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006950	response to stress	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0007019	microtubule depolymerizat ion	IEA	biological_process
GO:0007616	long-term memory	TAS	biological_process
GO:0008217	regulation of blood press ure	TAS	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0010765	positive regulation of so dium ion transport	IBA	biological_process
GO:0015459	potassium channel regulat or activity	TAS	molecular_function
GO:0017080	sodium channel regulator activity	TAS	molecular_function
GO:0017081	chloride channel regulato r activity	TAS	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IBA	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0031115	negative regulation of mi crotubule polymerization	IEA	biological_process
GO:0032411	positive regulation of tr ansporter activity	TAS	biological_process
GO:0034220	ion transmembrane transpo rt	TAS	biological_process
GO:0035556	intracellular signal tran sduction	IBA	biological_process
GO:0042127	regulation of cell prolif eration	TAS	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043402	glucocorticoid mediated s ignaling pathway	IEA	biological_process
GO:0043423	3-phosphoinositide-depend ent protein kinase bindin g	IEA	molecular_function
GO:0048037	cofactor binding	IEA	molecular_function
GO:0048156	tau protein binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048812	neuron projection morphog enesis	IBA	biological_process
GO:0050775	positive regulation of de ndrite morphogenesis	IEA	biological_process
GO:0050790	regulation of catalytic a ctivity	TAS	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0060453	regulation of gastric aci d secretion	TAS	biological_process
GO:0070294	renal sodium ion absorpti on	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001558	regulation of cell growth	TAS	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004712	protein serine/threonine/ tyrosine kinase activity	IDA	molecular_function
GO:0005246	calcium channel regulator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IBA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006814	sodium ion transport	TAS	biological_process
GO:0006883	cellular sodium ion homeo stasis	IEA	biological_process
GO:0006883	cellular sodium ion homeo stasis	IBA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006950	response to stress	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0007019	microtubule depolymerizat ion	IEA	biological_process
GO:0007616	long-term memory	IEA	biological_process
GO:0007616	long-term memory	TAS	biological_process
GO:0008217	regulation of blood press ure	TAS	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0010765	positive regulation of so dium ion transport	IBA	biological_process
GO:0015459	potassium channel regulat or activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0017080	sodium channel regulator activity	TAS	molecular_function
GO:0017081	chloride channel regulato r activity	TAS	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IBA	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0031115	negative regulation of mi crotubule polymerization	IEA	biological_process
GO:0032411	positive regulation of tr ansporter activity	TAS	biological_process
GO:0034220	ion transmembrane transpo rt	TAS	biological_process
GO:0035556	intracellular signal tran sduction	IBA	biological_process
GO:0042127	regulation of cell prolif eration	TAS	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043402	glucocorticoid mediated s ignaling pathway	IEA	biological_process
GO:0043423	3-phosphoinositide-depend ent protein kinase bindin g	IEA	molecular_function
GO:0048037	cofactor binding	IEA	molecular_function
GO:0048156	tau protein binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048812	neuron projection morphog enesis	IEA	biological_process
GO:0048812	neuron projection morphog enesis	IBA	biological_process
GO:0050775	positive regulation of de ndrite morphogenesis	IEA	biological_process
GO:0050790	regulation of catalytic a ctivity	TAS	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0060453	regulation of gastric aci d secretion	TAS	biological_process
GO:0070294	renal sodium ion absorpti on	TAS	biological_process
GO:0001558	regulation of cell growth	TAS	biological_process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004712	protein serine/threonine/ tyrosine kinase activity	IDA	molecular_function
GO:0005246	calcium channel regulator activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006814	sodium ion transport	TAS	biological_process
GO:0006883	cellular sodium ion homeo stasis	IBA	biological_process
GO:0006950	response to stress	TAS	biological_process
GO:0007616	long-term memory	TAS	biological_process
GO:0008217	regulation of blood press ure	TAS	biological_process
GO:0010765	positive regulation of so dium ion transport	IBA	biological_process
GO:0015459	potassium channel regulat or activity	TAS	molecular_function
GO:0017080	sodium channel regulator activity	TAS	molecular_function
GO:0017081	chloride channel regulato r activity	TAS	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IBA	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0032411	positive regulation of tr ansporter activity	TAS	biological_process
GO:0034220	ion transmembrane transpo rt	TAS	biological_process
GO:0035556	intracellular signal tran sduction	IBA	biological_process
GO:0042127	regulation of cell prolif eration	TAS	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0048812	neuron projection morphog enesis	IBA	biological_process
GO:0050790	regulation of catalytic a ctivity	TAS	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0060453	regulation of gastric aci d secretion	TAS	biological_process
GO:0070294	renal sodium ion absorpti on	TAS	biological_process

KEGG pathways

hsa04150  mTOR signaling pathway
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway

Diseases

Associated diseases	References
Endometriosis	INFBASE26827666

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26827666	Endometrio sis						Show abstract