Endometriosis Knowledgebase

Search Result

Gene id

652

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

BMP4 Gene UCSC Ensembl

Aliases

BMP2B, BMP2B1, MCOPS6, OFC11, ZYME

Gene name

bone morphogenetic protein 4

Alternate names

bone morphogenetic protein 4, bone morphogenetic protein 2B,

Gene location

14q22.2 (53956861: 53949735) Exons: 6 NC_000014.9

Gene summary(Entrez)

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers. [provided by RefSeq, Jul 2016]

OMIM

112262

Protein Summary

Protein general information

P12644

Name: Bone morphogenetic protein 4 (BMP 4) (Bone morphogenetic protein 2B) (BMP 2B)

Length: 408 Mass: 46,555

Tissue specificity: Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.

Sequence

MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSK
SAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPEN
EVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWT
REKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVP
TELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Structural information

Interpro:	IPR029034 IPR001839 IPR001111 IPR015615 IPR017948
Prosite:	PS00250 PS51362
Pfam:	PF00019 PF00688
DIP:	5795
MINT:	1184353
STRING:	ENSP00000245451;

Other Databases

GeneCards: BMP4; Malacards: BMP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0001657	ureteric bud development	IDA	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IDA	biological_process
GO:0001822	kidney development	IMP	biological_process
GO:0001823	mesonephros development	IEP	biological_process
GO:0001843	neural tube closure	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0001958	endochondral ossification	ISS	biological_process
GO:0002043	blood vessel endothelial cell proliferation involv ed in sprouting angiogene sis	IDA	biological_process
GO:0002062	chondrocyte differentiati on	ISS	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0002320	lymphoid progenitor cell differentiation	IMP	biological_process
GO:0003014	renal system process	IEA	biological_process
GO:0003130	BMP signaling pathway inv olved in heart induction	IMP	biological_process
GO:0003139	secondary heart field spe cification	IMP	biological_process
GO:0003197	endocardial cushion devel opment	TAS	biological_process
GO:0003279	cardiac septum developmen t	TAS	biological_process
GO:0003323	type B pancreatic cell de velopment	IDA	biological_process
GO:0003337	mesenchymal to epithelial transition involved in m etanephros morphogenesis	IDA	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007182	common-partner SMAD prote in phosphorylation	IDA	biological_process
GO:0007224	smoothened signaling path way	IEP	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007500	mesodermal cell fate dete rmination	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009791	post-embryonic developmen t	IDA	biological_process
GO:0009948	anterior/posterior axis s pecification	IEA	biological_process
GO:0010159	specification of animal o rgan position	IEA	biological_process
GO:0010453	regulation of cell fate c ommitment	IDA	biological_process
GO:0010524	positive regulation of ca lcium ion transport into cytosol	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IMP	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010942	positive regulation of ce ll death	IDA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0021537	telencephalon development	IDA	biological_process
GO:0021904	dorsal/ventral neural tub e patterning	IEA	biological_process
GO:0021978	telencephalon regionaliza tion	IEA	biological_process
GO:0021983	pituitary gland developme nt	IEA	biological_process
GO:0030218	erythrocyte differentiati on	IEA	biological_process
GO:0030224	monocyte differentiation	IDA	biological_process
GO:0030225	macrophage differentiatio n	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030509	BMP signaling pathway	IMP	biological_process
GO:0030509	BMP signaling pathway	IMP	biological_process
GO:0030509	BMP signaling pathway	IDA	biological_process
GO:0030509	BMP signaling pathway	IDA	biological_process
GO:0030513	positive regulation of BM P signaling pathway	ISS	biological_process
GO:0032092	positive regulation of pr otein binding	IDA	biological_process
GO:0032331	negative regulation of ch ondrocyte differentiation	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032526	response to retinoic acid	IEA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033085	negative regulation of T cell differentiation in t hymus	IMP	biological_process
GO:0033088	negative regulation of im mature T cell proliferati on in thymus	IMP	biological_process
GO:0033574	response to testosterone	IEA	biological_process
GO:0034504	protein localization to n ucleus	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IEA	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IEA	biological_process
GO:0035990	tendon cell differentiati on	ISS	biological_process
GO:0035993	deltoid tuberosity develo pment	ISS	biological_process
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042060	wound healing	IEA	biological_process
GO:0042306	regulation of protein imp ort into nucleus	IDA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0042476	odontogenesis	IGI	biological_process
GO:0042487	regulation of odontogenes is of dentin-containing t ooth	IEA	biological_process
GO:0042733	embryonic digit morphogen esis	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043401	steroid hormone mediated signaling pathway	IMP	biological_process
GO:0043407	negative regulation of MA P kinase activity	IDA	biological_process
GO:0043587	tongue morphogenesis	IEA	biological_process
GO:0045603	positive regulation of en dothelial cell differenti ation	IEA	biological_process
GO:0045606	positive regulation of ep idermal cell differentiat ion	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IDA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045778	positive regulation of os sification	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045839	negative regulation of mi totic nuclear division	IDA	biological_process
GO:0045843	negative regulation of st riated muscle tissue deve lopment	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048286	lung alveolus development	IDA	biological_process
GO:0048392	intermediate mesodermal c ell differentiation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048663	neuron fate commitment	IEA	biological_process
GO:0048701	embryonic cranial skeleto n morphogenesis	IEA	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0048745	smooth muscle tissue deve lopment	ISS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051150	regulation of smooth musc le cell differentiation	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0055020	positive regulation of ca rdiac muscle fiber develo pment	IMP	biological_process
GO:0060033	anatomical structure regr ession	IEA	biological_process
GO:0060041	retina development in cam era-type eye	IEA	biological_process
GO:0060113	inner ear receptor cell d ifferentiation	IEA	biological_process
GO:0060197	cloacal septation	IEA	biological_process
GO:0060235	lens induction in camera- type eye	IEA	biological_process
GO:0060272	embryonic skeletal joint morphogenesis	IEA	biological_process
GO:0060363	cranial suture morphogene sis	IEA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060393	regulation of pathway-res tricted SMAD protein phos phorylation	IDA	biological_process
GO:0060395	SMAD protein signal trans duction	IDA	biological_process
GO:0060425	lung morphogenesis	IDA	biological_process
GO:0060433	bronchus development	IDA	biological_process
GO:0060438	trachea development	IDA	biological_process
GO:0060440	trachea formation	IEA	biological_process
GO:0060441	epithelial tube branching involved in lung morphog enesis	IDA	biological_process
GO:0060442	branching involved in pro state gland morphogenesis	IEA	biological_process
GO:0060449	bud elongation involved i n lung branching	IEA	biological_process
GO:0060462	lung lobe development	IEA	biological_process
GO:0060502	epithelial cell prolifera tion involved in lung mor phogenesis	IDA	biological_process
GO:0060503	bud dilation involved in lung branching	IDA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060592	mammary gland formation	IEA	biological_process
GO:0060684	epithelial-mesenchymal ce ll signaling	IEA	biological_process
GO:0060686	negative regulation of pr ostatic bud formation	IEA	biological_process
GO:0060687	regulation of branching i nvolved in prostate gland morphogenesis	IEA	biological_process
GO:0061036	positive regulation of ca rtilage development	IDA	biological_process
GO:0061047	positive regulation of br anching involved in lung morphogenesis	ISS	biological_process
GO:0061149	BMP signaling pathway inv olved in ureter morphogen esis	ISS	biological_process
GO:0061151	BMP signaling pathway inv olved in renal system seg mentation	ISS	biological_process
GO:0061155	pulmonary artery endothel ial tube morphogenesis	IDA	biological_process
GO:0070244	negative regulation of th ymocyte apoptotic process	IMP	biological_process
GO:0070368	positive regulation of he patocyte differentiation	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070700	BMP receptor binding	IDA	molecular_function
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071731	response to nitric oxide	IEA	biological_process
GO:0071773	cellular response to BMP stimulus	IMP	biological_process
GO:0071893	BMP signaling pathway inv olved in nephric duct for mation	IDA	biological_process
GO:0072001	renal system development	IEP	biological_process
GO:0072015	glomerular visceral epith elial cell development	IEA	biological_process
GO:0072097	negative regulation of br anch elongation involved in ureteric bud branching by BMP signaling pathway	IDA	biological_process
GO:0072097	negative regulation of br anch elongation involved in ureteric bud branching by BMP signaling pathway	IDA	biological_process
GO:0072101	specification of ureteric bud anterior/posterior s ymmetry by BMP signaling pathway	IDA	biological_process
GO:0072101	specification of ureteric bud anterior/posterior s ymmetry by BMP signaling pathway	IDA	biological_process
GO:0072104	glomerular capillary form ation	ISS	biological_process
GO:0072125	negative regulation of gl omerular mesangial cell p roliferation	IDA	biological_process
GO:0072138	mesenchymal cell prolifer ation involved in ureteri c bud development	IEA	biological_process
GO:0072161	mesenchymal cell differen tiation involved in kidne y development	IEA	biological_process
GO:0072192	ureter epithelial cell di fferentiation	ISS	biological_process
GO:0072193	ureter smooth muscle cell differentiation	ISS	biological_process
GO:0072198	mesenchymal cell prolifer ation involved in ureter development	IEA	biological_process
GO:0072200	negative regulation of me senchymal cell proliferat ion involved in ureter de velopment	IDA	biological_process
GO:0072205	metanephric collecting du ct development	ISS	biological_process
GO:0090184	positive regulation of ki dney development	IDA	biological_process
GO:0090191	negative regulation of br anching involved in urete ric bud morphogenesis	IDA	biological_process
GO:0090191	negative regulation of br anching involved in urete ric bud morphogenesis	IDA	biological_process
GO:0090194	negative regulation of gl omerulus development	IDA	biological_process
GO:0097067	cellular response to thyr oid hormone stimulus	IEA	biological_process
GO:1901341	positive regulation of st ore-operated calcium chan nel activity	IEA	biological_process
GO:1902462	positive regulation of me senchymal stem cell proli feration	IEA	biological_process
GO:2000005	negative regulation of me tanephric S-shaped body m orphogenesis	IDA	biological_process
GO:2000007	negative regulation of me tanephric comma-shaped bo dy morphogenesis	IDA	biological_process
GO:2000105	positive regulation of DN A-dependent DNA replicati on	IDA	biological_process
GO:2000137	negative regulation of ce ll proliferation involved in heart morphogenesis	IMP	biological_process
GO:2000353	positive regulation of en dothelial cell apoptotic process	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0001501	skeletal system developme nt	IEA	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001568	blood vessel development	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0001656	metanephros development	IEA	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001657	ureteric bud development	IDA	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IEA	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IDA	biological_process
GO:0001707	mesoderm formation	IEA	biological_process
GO:0001759	organ induction	IEA	biological_process
GO:0001822	kidney development	IEA	biological_process
GO:0001822	kidney development	IMP	biological_process
GO:0001823	mesonephros development	IEP	biological_process
GO:0001843	neural tube closure	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IEA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0001944	vasculature development	IEA	biological_process
GO:0001958	endochondral ossification	IEA	biological_process
GO:0001958	endochondral ossification	ISS	biological_process
GO:0002043	blood vessel endothelial cell proliferation involv ed in sprouting angiogene sis	IDA	biological_process
GO:0002062	chondrocyte differentiati on	IEA	biological_process
GO:0002062	chondrocyte differentiati on	ISS	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0002320	lymphoid progenitor cell differentiation	IMP	biological_process
GO:0003014	renal system process	IEA	biological_process
GO:0003130	BMP signaling pathway inv olved in heart induction	IMP	biological_process
GO:0003139	secondary heart field spe cification	IMP	biological_process
GO:0003197	endocardial cushion devel opment	TAS	biological_process
GO:0003279	cardiac septum developmen t	TAS	biological_process
GO:0003323	type B pancreatic cell de velopment	IDA	biological_process
GO:0003337	mesenchymal to epithelial transition involved in m etanephros morphogenesis	IDA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007182	common-partner SMAD prote in phosphorylation	IDA	biological_process
GO:0007224	smoothened signaling path way	IEP	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007281	germ cell development	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007500	mesodermal cell fate dete rmination	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009791	post-embryonic developmen t	IEA	biological_process
GO:0009791	post-embryonic developmen t	IDA	biological_process
GO:0009888	tissue development	IEA	biological_process
GO:0009948	anterior/posterior axis s pecification	IEA	biological_process
GO:0010159	specification of animal o rgan position	IEA	biological_process
GO:0010453	regulation of cell fate c ommitment	IDA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0010524	positive regulation of ca lcium ion transport into cytosol	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IMP	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010942	positive regulation of ce ll death	IDA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0021537	telencephalon development	IDA	biological_process
GO:0021904	dorsal/ventral neural tub e patterning	IEA	biological_process
GO:0021978	telencephalon regionaliza tion	IEA	biological_process
GO:0021983	pituitary gland developme nt	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030218	erythrocyte differentiati on	IEA	biological_process
GO:0030224	monocyte differentiation	IDA	biological_process
GO:0030225	macrophage differentiatio n	IDA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030326	embryonic limb morphogene sis	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IEA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030509	BMP signaling pathway	IEA	biological_process
GO:0030509	BMP signaling pathway	IMP	biological_process
GO:0030509	BMP signaling pathway	IMP	biological_process
GO:0030509	BMP signaling pathway	IDA	biological_process
GO:0030509	BMP signaling pathway	IDA	biological_process
GO:0030513	positive regulation of BM P signaling pathway	IEA	biological_process
GO:0030513	positive regulation of BM P signaling pathway	ISS	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0032092	positive regulation of pr otein binding	IDA	biological_process
GO:0032331	negative regulation of ch ondrocyte differentiation	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032526	response to retinoic acid	IEA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033085	negative regulation of T cell differentiation in t hymus	IMP	biological_process
GO:0033088	negative regulation of im mature T cell proliferati on in thymus	IMP	biological_process
GO:0033574	response to testosterone	IEA	biological_process
GO:0034504	protein localization to n ucleus	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IEA	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IEA	biological_process
GO:0035990	tendon cell differentiati on	IEA	biological_process
GO:0035990	tendon cell differentiati on	ISS	biological_process
GO:0035993	deltoid tuberosity develo pment	IEA	biological_process
GO:0035993	deltoid tuberosity develo pment	ISS	biological_process
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0040007	growth	IEA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042060	wound healing	IEA	biological_process
GO:0042306	regulation of protein imp ort into nucleus	IDA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0042476	odontogenesis	IEA	biological_process
GO:0042476	odontogenesis	IGI	biological_process
GO:0042487	regulation of odontogenes is of dentin-containing t ooth	IEA	biological_process
GO:0042733	embryonic digit morphogen esis	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043010	camera-type eye developme nt	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043401	steroid hormone mediated signaling pathway	IMP	biological_process
GO:0043407	negative regulation of MA P kinase activity	IDA	biological_process
GO:0043587	tongue morphogenesis	IEA	biological_process
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045595	regulation of cell differ entiation	IEA	biological_process
GO:0045597	positive regulation of ce ll differentiation	IEA	biological_process
GO:0045603	positive regulation of en dothelial cell differenti ation	IEA	biological_process
GO:0045606	positive regulation of ep idermal cell differentiat ion	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IDA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045778	positive regulation of os sification	IEA	biological_process
GO:0045778	positive regulation of os sification	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045839	negative regulation of mi totic nuclear division	IDA	biological_process
GO:0045843	negative regulation of st riated muscle tissue deve lopment	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048286	lung alveolus development	IDA	biological_process
GO:0048333	mesodermal cell different iation	IEA	biological_process
GO:0048392	intermediate mesodermal c ell differentiation	IDA	biological_process
GO:0048593	camera-type eye morphogen esis	IEA	biological_process
GO:0048598	embryonic morphogenesis	IEA	biological_process
GO:0048646	anatomical structure form ation involved in morphog enesis	IEA	biological_process
GO:0048660	regulation of smooth musc le cell proliferation	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048663	neuron fate commitment	IEA	biological_process
GO:0048701	embryonic cranial skeleto n morphogenesis	IEA	biological_process
GO:0048704	embryonic skeletal system morphogenesis	IEA	biological_process
GO:0048706	embryonic skeletal system development	IEA	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0048745	smooth muscle tissue deve lopment	IEA	biological_process
GO:0048745	smooth muscle tissue deve lopment	ISS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051145	smooth muscle cell differ entiation	IEA	biological_process
GO:0051150	regulation of smooth musc le cell differentiation	IEA	biological_process
GO:0051216	cartilage development	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0055020	positive regulation of ca rdiac muscle fiber develo pment	IMP	biological_process
GO:0060033	anatomical structure regr ession	IEA	biological_process
GO:0060041	retina development in cam era-type eye	IEA	biological_process
GO:0060113	inner ear receptor cell d ifferentiation	IEA	biological_process
GO:0060197	cloacal septation	IEA	biological_process
GO:0060235	lens induction in camera- type eye	IEA	biological_process
GO:0060272	embryonic skeletal joint morphogenesis	IEA	biological_process
GO:0060348	bone development	IEA	biological_process
GO:0060363	cranial suture morphogene sis	IEA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060393	regulation of pathway-res tricted SMAD protein phos phorylation	IDA	biological_process
GO:0060395	SMAD protein signal trans duction	IEA	biological_process
GO:0060395	SMAD protein signal trans duction	IDA	biological_process
GO:0060425	lung morphogenesis	IDA	biological_process
GO:0060429	epithelium development	IEA	biological_process
GO:0060433	bronchus development	IDA	biological_process
GO:0060438	trachea development	IDA	biological_process
GO:0060440	trachea formation	IEA	biological_process
GO:0060441	epithelial tube branching involved in lung morphog enesis	IEA	biological_process
GO:0060441	epithelial tube branching involved in lung morphog enesis	IDA	biological_process
GO:0060442	branching involved in pro state gland morphogenesis	IEA	biological_process
GO:0060449	bud elongation involved i n lung branching	IEA	biological_process
GO:0060462	lung lobe development	IEA	biological_process
GO:0060502	epithelial cell prolifera tion involved in lung mor phogenesis	IDA	biological_process
GO:0060503	bud dilation involved in lung branching	IDA	biological_process
GO:0060512	prostate gland morphogene sis	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060592	mammary gland formation	IEA	biological_process
GO:0060684	epithelial-mesenchymal ce ll signaling	IEA	biological_process
GO:0060686	negative regulation of pr ostatic bud formation	IEA	biological_process
GO:0060687	regulation of branching i nvolved in prostate gland morphogenesis	IEA	biological_process
GO:0060688	regulation of morphogenes is of a branching structu re	IEA	biological_process
GO:0061035	regulation of cartilage d evelopment	IEA	biological_process
GO:0061036	positive regulation of ca rtilage development	IDA	biological_process
GO:0061047	positive regulation of br anching involved in lung morphogenesis	IEA	biological_process
GO:0061047	positive regulation of br anching involved in lung morphogenesis	ISS	biological_process
GO:0061149	BMP signaling pathway inv olved in ureter morphogen esis	IEA	biological_process
GO:0061149	BMP signaling pathway inv olved in ureter morphogen esis	ISS	biological_process
GO:0061151	BMP signaling pathway inv olved in renal system seg mentation	IEA	biological_process
GO:0061151	BMP signaling pathway inv olved in renal system seg mentation	ISS	biological_process
GO:0061155	pulmonary artery endothel ial tube morphogenesis	IDA	biological_process
GO:0070244	negative regulation of th ymocyte apoptotic process	IMP	biological_process
GO:0070368	positive regulation of he patocyte differentiation	IEA	biological_process
GO:0070372	regulation of ERK1 and ER K2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070700	BMP receptor binding	IDA	molecular_function
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0071731	response to nitric oxide	IEA	biological_process
GO:0071773	cellular response to BMP stimulus	IEA	biological_process
GO:0071773	cellular response to BMP stimulus	IMP	biological_process
GO:0071893	BMP signaling pathway inv olved in nephric duct for mation	IDA	biological_process
GO:0072001	renal system development	IEA	biological_process
GO:0072001	renal system development	IEP	biological_process
GO:0072015	glomerular visceral epith elial cell development	IEA	biological_process
GO:0072097	negative regulation of br anch elongation involved in ureteric bud branching by BMP signaling pathway	IDA	biological_process
GO:0072097	negative regulation of br anch elongation involved in ureteric bud branching by BMP signaling pathway	IDA	biological_process
GO:0072101	specification of ureteric bud anterior/posterior s ymmetry by BMP signaling pathway	IDA	biological_process
GO:0072101	specification of ureteric bud anterior/posterior s ymmetry by BMP signaling pathway	IDA	biological_process
GO:0072104	glomerular capillary form ation	IEA	biological_process
GO:0072104	glomerular capillary form ation	ISS	biological_process
GO:0072125	negative regulation of gl omerular mesangial cell p roliferation	IDA	biological_process
GO:0072138	mesenchymal cell prolifer ation involved in ureteri c bud development	IEA	biological_process
GO:0072161	mesenchymal cell differen tiation involved in kidne y development	IEA	biological_process
GO:0072192	ureter epithelial cell di fferentiation	IEA	biological_process
GO:0072192	ureter epithelial cell di fferentiation	ISS	biological_process
GO:0072193	ureter smooth muscle cell differentiation	IEA	biological_process
GO:0072193	ureter smooth muscle cell differentiation	ISS	biological_process
GO:0072198	mesenchymal cell prolifer ation involved in ureter development	IEA	biological_process
GO:0072200	negative regulation of me senchymal cell proliferat ion involved in ureter de velopment	IDA	biological_process
GO:0072205	metanephric collecting du ct development	IEA	biological_process
GO:0072205	metanephric collecting du ct development	ISS	biological_process
GO:0090184	positive regulation of ki dney development	IDA	biological_process
GO:0090191	negative regulation of br anching involved in urete ric bud morphogenesis	IEA	biological_process
GO:0090191	negative regulation of br anching involved in urete ric bud morphogenesis	IDA	biological_process
GO:0090191	negative regulation of br anching involved in urete ric bud morphogenesis	IDA	biological_process
GO:0090194	negative regulation of gl omerulus development	IDA	biological_process
GO:0097067	cellular response to thyr oid hormone stimulus	IEA	biological_process
GO:1901341	positive regulation of st ore-operated calcium chan nel activity	IEA	biological_process
GO:1902462	positive regulation of me senchymal stem cell proli feration	IEA	biological_process
GO:2000005	negative regulation of me tanephric S-shaped body m orphogenesis	IDA	biological_process
GO:2000007	negative regulation of me tanephric comma-shaped bo dy morphogenesis	IDA	biological_process
GO:2000105	positive regulation of DN A-dependent DNA replicati on	IDA	biological_process
GO:2000137	negative regulation of ce ll proliferation involved in heart morphogenesis	IMP	biological_process
GO:2000353	positive regulation of en dothelial cell apoptotic process	IEA	biological_process
GO:2001012	mesenchymal cell differen tiation involved in renal system development	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0001657	ureteric bud development	IDA	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IDA	biological_process
GO:0001822	kidney development	IMP	biological_process
GO:0001823	mesonephros development	IEP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0001958	endochondral ossification	ISS	biological_process
GO:0002043	blood vessel endothelial cell proliferation involv ed in sprouting angiogene sis	IDA	biological_process
GO:0002062	chondrocyte differentiati on	ISS	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0002320	lymphoid progenitor cell differentiation	IMP	biological_process
GO:0003130	BMP signaling pathway inv olved in heart induction	IMP	biological_process
GO:0003139	secondary heart field spe cification	IMP	biological_process
GO:0003197	endocardial cushion devel opment	TAS	biological_process
GO:0003279	cardiac septum developmen t	TAS	biological_process
GO:0003323	type B pancreatic cell de velopment	IDA	biological_process
GO:0003337	mesenchymal to epithelial transition involved in m etanephros morphogenesis	IDA	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007182	common-partner SMAD prote in phosphorylation	IDA	biological_process
GO:0007224	smoothened signaling path way	IEP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009791	post-embryonic developmen t	IDA	biological_process
GO:0010453	regulation of cell fate c ommitment	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IMP	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010942	positive regulation of ce ll death	IDA	biological_process
GO:0021537	telencephalon development	IDA	biological_process
GO:0030224	monocyte differentiation	IDA	biological_process
GO:0030225	macrophage differentiatio n	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IDA	biological_process
GO:0030509	BMP signaling pathway	IMP	biological_process
GO:0030509	BMP signaling pathway	IMP	biological_process
GO:0030509	BMP signaling pathway	IDA	biological_process
GO:0030509	BMP signaling pathway	IDA	biological_process
GO:0030513	positive regulation of BM P signaling pathway	ISS	biological_process
GO:0032092	positive regulation of pr otein binding	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033085	negative regulation of T cell differentiation in t hymus	IMP	biological_process
GO:0033088	negative regulation of im mature T cell proliferati on in thymus	IMP	biological_process
GO:0034504	protein localization to n ucleus	IDA	biological_process
GO:0035990	tendon cell differentiati on	ISS	biological_process
GO:0035993	deltoid tuberosity develo pment	ISS	biological_process
GO:0039706	co-receptor binding	IPI	molecular_function
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042306	regulation of protein imp ort into nucleus	IDA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042476	odontogenesis	IGI	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043401	steroid hormone mediated signaling pathway	IMP	biological_process
GO:0043407	negative regulation of MA P kinase activity	IDA	biological_process
GO:0045606	positive regulation of ep idermal cell differentiat ion	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IDA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045778	positive regulation of os sification	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045839	negative regulation of mi totic nuclear division	IDA	biological_process
GO:0045843	negative regulation of st riated muscle tissue deve lopment	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048286	lung alveolus development	IDA	biological_process
GO:0048392	intermediate mesodermal c ell differentiation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048745	smooth muscle tissue deve lopment	ISS	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0055020	positive regulation of ca rdiac muscle fiber develo pment	IMP	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060393	regulation of pathway-res tricted SMAD protein phos phorylation	IDA	biological_process
GO:0060395	SMAD protein signal trans duction	IDA	biological_process
GO:0060425	lung morphogenesis	IDA	biological_process
GO:0060433	bronchus development	IDA	biological_process
GO:0060438	trachea development	IDA	biological_process
GO:0060441	epithelial tube branching involved in lung morphog enesis	IDA	biological_process
GO:0060502	epithelial cell prolifera tion involved in lung mor phogenesis	IDA	biological_process
GO:0060503	bud dilation involved in lung branching	IDA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0061036	positive regulation of ca rtilage development	IDA	biological_process
GO:0061047	positive regulation of br anching involved in lung morphogenesis	ISS	biological_process
GO:0061149	BMP signaling pathway inv olved in ureter morphogen esis	ISS	biological_process
GO:0061151	BMP signaling pathway inv olved in renal system seg mentation	ISS	biological_process
GO:0061155	pulmonary artery endothel ial tube morphogenesis	IDA	biological_process
GO:0070244	negative regulation of th ymocyte apoptotic process	IMP	biological_process
GO:0070700	BMP receptor binding	IDA	molecular_function
GO:0071773	cellular response to BMP stimulus	IMP	biological_process
GO:0071893	BMP signaling pathway inv olved in nephric duct for mation	IDA	biological_process
GO:0072001	renal system development	IEP	biological_process
GO:0072097	negative regulation of br anch elongation involved in ureteric bud branching by BMP signaling pathway	IDA	biological_process
GO:0072097	negative regulation of br anch elongation involved in ureteric bud branching by BMP signaling pathway	IDA	biological_process
GO:0072101	specification of ureteric bud anterior/posterior s ymmetry by BMP signaling pathway	IDA	biological_process
GO:0072101	specification of ureteric bud anterior/posterior s ymmetry by BMP signaling pathway	IDA	biological_process
GO:0072104	glomerular capillary form ation	ISS	biological_process
GO:0072125	negative regulation of gl omerular mesangial cell p roliferation	IDA	biological_process
GO:0072192	ureter epithelial cell di fferentiation	ISS	biological_process
GO:0072193	ureter smooth muscle cell differentiation	ISS	biological_process
GO:0072200	negative regulation of me senchymal cell proliferat ion involved in ureter de velopment	IDA	biological_process
GO:0072205	metanephric collecting du ct development	ISS	biological_process
GO:0090184	positive regulation of ki dney development	IDA	biological_process
GO:0090191	negative regulation of br anching involved in urete ric bud morphogenesis	IDA	biological_process
GO:0090191	negative regulation of br anching involved in urete ric bud morphogenesis	IDA	biological_process
GO:0090194	negative regulation of gl omerulus development	IDA	biological_process
GO:2000005	negative regulation of me tanephric S-shaped body m orphogenesis	IDA	biological_process
GO:2000007	negative regulation of me tanephric comma-shaped bo dy morphogenesis	IDA	biological_process
GO:2000105	positive regulation of DN A-dependent DNA replicati on	IDA	biological_process
GO:2000137	negative regulation of ce ll proliferation involved in heart morphogenesis	IMP	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05418  Fluid shear stress and atherosclerosis
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04350  TGF-beta signaling pathway
hsa05217  Basal cell carcinoma

Diseases

Associated diseases	References
Anophthalmia and microphthalmia	KEGG: H01027
Endometriosis	PMID: 24661731
Hemochromatosis	PMID: 17847004
Hyperandrogenism	PMID: 28572510
Hypospadias	PMID: 17003840
Isolated orofacial clefts	KEGG: H00516
Mullerian duct differentiation	PMID: 23460397
Neural tube defects	PMID: 12404109
Polycystic ovary syndrome (PCOS)	PMID: 23243014
Sertoli cell-only syndrome (SCOS)	PMID: 25977194
M�llerian duct differentiation	INFBASE23460397
Endometriosis	INFBASE23460397

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24661731	Endometrio sis			69 (30 with end ometriosis, 39 women undergoin g ICSI for male infertility)		WNT4 WNT5a WNT1 ?-catenin BMP4	Show abstract
23460397	Endometrio sis					BMP4 GREM1	Show abstract