Endometriosis Knowledgebase

Search Result

Gene id

6590

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SLPI Gene UCSC Ensembl

Aliases

ALK1, ALP, BLPI, HUSI, HUSI-I, MPI, WAP4, WFDC4

Gene name

secretory leukocyte peptidase inhibitor

Alternate names

antileukoproteinase, HUSI-1, WAP four-disulfide core domain protein 4, mucus proteinase inhibitor, protease inhibitor WAP4, secretory leukocyte protease inhibitor (antileukoproteinase), seminal proteinase inhibitor,

Gene location

20q13.12 (45254563: 45252238) Exons: 4 NC_000020.11

Gene summary(Entrez)

This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity. [provided by RefSeq, Nov 2014]

OMIM

107285

Protein Summary

Protein general information

P03973

Name: Antileukoproteinase (ALP) (BLPI) (HUSI 1) (Mucus proteinase inhibitor) (MPI) (Protease inhibitor WAP4) (Secretory leukocyte protease inhibitor) (Seminal proteinase inhibitor) (WAP four disulfide core domain protein 4)

Length: 132 Mass: 14,326

Tissue specificity: Detected in blood plasma (PubMed

Sequence

MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDP
VDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

Structural information

Protein Domains	WAP (28-76) WAP (82-130)
Interpro:	IPR029712 IPR008197
Prosite:	PS51390
Pfam:	PF00095
PDB:	2Z7F 4DOQ
PDBsum:	2Z7F 4DOQ
STRING:	ENSP00000342082;

Other Databases

GeneCards: SLPI; Malacards: SLPI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004866	endopeptidase inhibitor a ctivity	TAS	molecular_function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006955	immune response	ISS	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	ISS	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032496	response to lipopolysacch aride	ISS	biological_process
GO:0045071	negative regulation of vi ral genome replication	IDA	biological_process
GO:0045087	innate immune response	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0002376	immune system process	IEA	biological_process
GO:0004866	endopeptidase inhibitor a ctivity	IEA	molecular_function
GO:0004866	endopeptidase inhibitor a ctivity	TAS	molecular_function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular_function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	ISS	biological_process
GO:0010466	negative regulation of pe ptidase activity	IEA	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	ISS	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030414	peptidase inhibitor activ ity	IEA	molecular_function
GO:0030414	peptidase inhibitor activ ity	IEA	molecular_function
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032496	response to lipopolysacch aride	ISS	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0045071	negative regulation of vi ral genome replication	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	ISS	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0004866	endopeptidase inhibitor a ctivity	TAS	molecular_function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006955	immune response	ISS	biological_process
GO:0019731	antibacterial humoral res ponse	ISS	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032496	response to lipopolysacch aride	ISS	biological_process
GO:0045071	negative regulation of vi ral genome replication	IDA	biological_process
GO:0045087	innate immune response	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 2311256
Endometriosis	PMID: 10560990
Leukocytospermia	PMID: 9809675
Endometriosis	INFBASE2311256

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
2311256	Endometrio sis	25 (18 patients with untreated endometriosis, 7 controls)	ALP	Show abstract
10956555	Endometrio sis		SLPI	Show abstract
10560990	Endometrio sis	48 (27 women wi th endometriosi s, 21 women wit hout endometrio sis)	SLPI	Show abstract