Endometriosis Knowledgebase

Search Result

Gene id

6678

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SPARC Gene UCSC Ensembl

Aliases

BM-40, OI17, ON

Gene name

secreted protein acidic and cysteine rich

Alternate names

SPARC, basement-membrane protein 40, secreted protein, acidic, cysteine-rich (osteonectin),

Gene location

5q33.1 (151687053: 151661095) Exons: 10 NC_000005.10

Gene summary(Entrez)

This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2015]

OMIM

182120

Protein Summary

Protein general information

P09486

Name: SPARC (Basement membrane protein 40) (BM 40) (Osteonectin) (ON) (Secreted protein acidic and rich in cysteine)

Length: 303 Mass: 34,632

Sequence

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNH
HCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCK
YIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYN
MYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI

Structural information

Protein Domains	Follistatin-like (71-93) Kazal-like. (89-151) EF-hand. (261-296)
Interpro:	IPR011992 IPR018247 IPR003645 IPR015369 IPR002350 IPR001999 IPR019577
Prosite:	PS00018 PS51465 PS00612 PS00613
Pfam:	PF09289 PF00050 PF10591
CDD:	cd00252
PDB:	1BMO 1NUB 1SRA 2V53
PDBsum:	1BMO 1NUB 1SRA 2V53
DIP:	46426
MINT:	3006855
STRING:	ENSP00000231061;

Other Databases

GeneCards: SPARC; Malacards: SPARC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001503	ossification	IEA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IDA	molecular_function
GO:0005518	collagen binding	IDA	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0009629	response to gravity	IEA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010288	response to lead ion	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0016363	nuclear matrix	IDA	cellular_component
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0022604	regulation of cell morpho genesis	IDA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0031091	platelet alpha granule	IDA	cellular_component
GO:0031092	platelet alpha granule me mbrane	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033591	response to L-ascorbic ac id	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0046686	response to cadmium ion	IEA	biological_process
GO:0048839	inner ear development	IEA	biological_process
GO:0050840	extracellular matrix bind ing	IEA	molecular_function
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0060348	bone development	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0001503	ossification	IEA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IDA	molecular_function
GO:0005518	collagen binding	IDA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0009629	response to gravity	IEA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010288	response to lead ion	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0016363	nuclear matrix	IDA	cellular_component
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0022604	regulation of cell morpho genesis	IDA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0031091	platelet alpha granule	IDA	cellular_component
GO:0031092	platelet alpha granule me mbrane	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033591	response to L-ascorbic ac id	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0046686	response to cadmium ion	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048839	inner ear development	IEA	biological_process
GO:0050840	extracellular matrix bind ing	IEA	molecular_function
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0060348	bone development	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0001937	negative regulation of en dothelial cell proliferat ion	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IDA	molecular_function
GO:0005518	collagen binding	IDA	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0016363	nuclear matrix	IDA	cellular_component
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0022604	regulation of cell morpho genesis	IDA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031091	platelet alpha granule	IDA	cellular_component
GO:0031092	platelet alpha granule me mbrane	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 19200988
Endometriosis	INFBASE19200988
Osteoporosis	PMID: 18084690
Polycystic ovary syndrome (PCOS)	PMID: 22904171
Scleroderma	PMID: 12428242

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19200988	Endometrio sis			28 (17 patients in whom endome triosis, 11 hea lthy fertile wo men)		SPARC	Show abstract