Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6714
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol SRC   Gene   UCSC   Ensembl
Aliases ASV, SRC1, THC6, c-SRC, p60-Src
Gene name SRC proto-oncogene, non-receptor tyrosine kinase
Alternate names proto-oncogene tyrosine-protein kinase Src, proto-oncogene c-Src, protooncogene SRC, Rous sarcoma, tyrosine kinase pp60c-src, tyrosine-protein kinase SRC-1, v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog,
Gene location 20q11.23 (37344684: 37405431)     Exons: 17     NC_000020.11
Gene summary(Entrez) This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
OMIM 190090

Protein Summary

Protein general information P12931  

Name: Proto oncogene tyrosine protein kinase Src (EC 2.7.10.2) (Proto oncogene c Src) (pp60c src) (p60 Src)

Length: 536  Mass: 59,835

Tissue specificity: Expressed ubiquitously. Platelets, neurons and osteoclasts express 5-fold to 200-fold higher levels than most other tissues.

Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTS
PQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEE
WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNS
LQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIAS
GMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWS
FGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTS
TEPQYQPGENL
Structural information
Protein Domains
SH3. (84-145)
SH2. (151-248)
Protein (270-523)
Interpro:  IPR011009 IPR000719 IPR017441 IPR001245 IPR000980 IPR001452 IPR008266 IPR020635
Prosite:   PS00107 PS50011 PS00109 PS50001 PS50002

Pfam:  
PF07714 PF00017 PF00018

PDB:  
1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ
PDBsum:   1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ

DIP:  
1059
MINT:   93621
STRING:   ENSP00000350941;
Other Databases GeneCards:  SRC;  Malacards:  SRC

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
TAS biological_process
GO:0004672 protein kinase activity
IDA molecular_function
GO:0004672 protein kinase activity
TAS molecular_function
GO:0004672 protein kinase activity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IDA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IDA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
TAS molecular_function
GO:0005070 SH3/SH2 adaptor activity
TAS molecular_function
GO:0005080 protein kinase C binding
IEA molecular_function
GO:0005102 receptor binding
IPI molecular_function
GO:0005158 insulin receptor binding
IEA molecular_function
GO:0005178 integrin binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005524 ATP binding
IEA molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005739 mitochondrion
IDA cellular_component
GO:0005743 mitochondrial inner membr
ane
IDA cellular_component
GO:0005764 lysosome
IDA cellular_component
GO:0005770 late endosome
IDA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005884 actin filament
IEA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005901 caveola
IDA cellular_component
GO:0007049 cell cycle
IEA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007172 signal complex assembly
TAS biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
IBA biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
TAS biological_process
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
IMP biological_process
GO:0007229 integrin-mediated signali
ng pathway
IMP biological_process
GO:0007417 central nervous system de
velopment
IBA biological_process
GO:0008022 protein C-terminus bindin
g
IEA molecular_function
GO:0008283 cell proliferation
IEA biological_process
GO:0009612 response to mechanical st
imulus
IEA biological_process
GO:0009615 response to virus
IEA biological_process
GO:0010447 response to acidic pH
IEA biological_process
GO:0010632 regulation of epithelial
cell migration
IMP biological_process
GO:0010634 positive regulation of ep
ithelial cell migration
IMP biological_process
GO:0010641 positive regulation of pl
atelet-derived growth fac
tor receptor signaling pa
thway
IEA biological_process
GO:0010907 positive regulation of gl
ucose metabolic process
IEA biological_process
GO:0014069 postsynaptic density
IEA cellular_component
GO:0014911 positive regulation of sm
ooth muscle cell migratio
n
IEA biological_process
GO:0016032 viral process
IEA biological_process
GO:0016301 kinase activity
TAS molecular_function
GO:0016337 single organismal cell-ce
ll adhesion
IEA biological_process
GO:0018105 peptidyl-serine phosphory
lation
IEA biological_process
GO:0018108 peptidyl-tyrosine phospho
rylation
IDA biological_process
GO:0019899 enzyme binding
IPI molecular_function
GO:0019900 kinase binding
IPI molecular_function
GO:0020037 heme binding
IDA molecular_function
GO:0022407 regulation of cell-cell a
dhesion
IMP biological_process
GO:0030168 platelet activation
TAS biological_process
GO:0030331 estrogen receptor binding
IEA molecular_function
GO:0030520 intracellular estrogen re
ceptor signaling pathway
IBA biological_process
GO:0030900 forebrain development
IEA biological_process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IBA cellular_component
GO:0031295 T cell costimulation
TAS biological_process
GO:0031295 T cell costimulation
TAS biological_process
GO:0031648 protein destabilization
IEA biological_process
GO:0031667 response to nutrient leve
ls
IEA biological_process
GO:0031954 positive regulation of pr
otein autophosphorylation
IEA biological_process
GO:0032148 activation of protein kin
ase B activity
IEA biological_process
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
IMP biological_process
GO:0032463 negative regulation of pr
otein homooligomerization
IMP biological_process
GO:0032587 ruffle membrane
IEA cellular_component
GO:0032869 cellular response to insu
lin stimulus
IEA biological_process
GO:0033146 regulation of intracellul
ar estrogen receptor sign
aling pathway
IEA biological_process
GO:0033625 positive regulation of in
tegrin activation
TAS biological_process
GO:0034332 adherens junction organiz
ation
IEA biological_process
GO:0034446 substrate adhesion-depend
ent cell spreading
IEA biological_process
GO:0034614 cellular response to reac
tive oxygen species
IEA biological_process
GO:0035556 intracellular signal tran
sduction
IDA biological_process
GO:0036035 osteoclast development
IBA biological_process
GO:0036120 cellular response to plat
elet-derived growth facto
r stimulus
IEA biological_process
GO:0038083 peptidyl-tyrosine autopho
sphorylation
IBA biological_process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
TAS biological_process
GO:0038128 ERBB2 signaling pathway
TAS biological_process
GO:0042127 regulation of cell prolif
eration
IBA biological_process
GO:0042169 SH2 domain binding
IPI molecular_function
GO:0042493 response to drug
IEA biological_process
GO:0042542 response to hydrogen pero
xide
IEA biological_process
GO:0043005 neuron projection
IEA cellular_component
GO:0043065 positive regulation of ap
optotic process
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IMP biological_process
GO:0043114 regulation of vascular pe
rmeability
TAS biological_process
GO:0043149 stress fiber assembly
IMP biological_process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
IMP biological_process
GO:0043393 regulation of protein bin
ding
IEA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IEA biological_process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IEA biological_process
GO:0044325 ion channel binding
IPI molecular_function
GO:0044325 ion channel binding
IPI molecular_function
GO:0045056 transcytosis
IEA biological_process
GO:0045087 innate immune response
IBA biological_process
GO:0045124 regulation of bone resorp
tion
TAS biological_process
GO:0045453 bone resorption
ISS biological_process
GO:0045737 positive regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
IEA biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IEA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IEA biological_process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
IEA biological_process
GO:0046777 protein autophosphorylati
on
IDA biological_process
GO:0046875 ephrin receptor binding
IPI molecular_function
GO:0048008 platelet-derived growth f
actor receptor signaling
pathway
IBA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048011 neurotrophin TRK receptor
signaling pathway
IEA biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048471 perinuclear region of cyt
oplasm
IEA cellular_component
GO:0048477 oogenesis
IEA biological_process
GO:0050715 positive regulation of cy
tokine secretion
IEA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IC biological_process
GO:0050847 progesterone receptor sig
naling pathway
ISS biological_process
GO:0050847 progesterone receptor sig
naling pathway
IBA biological_process
GO:0050900 leukocyte migration
TAS biological_process
GO:0051219 phosphoprotein binding
IPI molecular_function
GO:0051385 response to mineralocorti
coid
IEA biological_process
GO:0051427 hormone receptor binding
IBA molecular_function
GO:0051602 response to electrical st
imulus
IEA biological_process
GO:0051726 regulation of cell cycle
IBA biological_process
GO:0051895 negative regulation of fo
cal adhesion assembly
ISS biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IMP biological_process
GO:0051902 negative regulation of mi
tochondrial depolarizatio
n
IMP biological_process
GO:0051974 negative regulation of te
lomerase activity
IMP biological_process
GO:0060065 uterus development
IEA biological_process
GO:0060444 branching involved in mam
mary gland duct morphogen
esis
IEA biological_process
GO:0060491 regulation of cell projec
tion assembly
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological_process
GO:0070555 response to interleukin-1
IMP biological_process
GO:0070851 growth factor receptor bi
nding
IPI molecular_function
GO:0071222 cellular response to lipo
polysaccharide
IEA biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
ISS biological_process
GO:0071393 cellular response to prog
esterone stimulus
ISS biological_process
GO:0071398 cellular response to fatt
y acid
IEA biological_process
GO:0071456 cellular response to hypo
xia
IEA biological_process
GO:0071498 cellular response to flui
d shear stress
IEA biological_process
GO:0071801 regulation of podosome as
sembly
IBA biological_process
GO:0071803 positive regulation of po
dosome assembly
IEA biological_process
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
ISS biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IEA biological_process
GO:0097110 scaffold protein binding
IPI molecular_function
GO:2000394 positive regulation of la
mellipodium morphogenesis
IMP biological_process
GO:2000573 positive regulation of DN
A biosynthetic process
IEA biological_process
GO:2000641 regulation of early endos
ome to late endosome tran
sport
IMP biological_process
GO:2000811 negative regulation of an
oikis
IMP biological_process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
IMP biological_process
GO:2001243 negative regulation of in
trinsic apoptotic signali
ng pathway
IMP biological_process
GO:2001286 regulation of caveolin-me
diated endocytosis
IMP biological_process
GO:0000166 nucleotide binding
IEA molecular_function
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
TAS biological_process
GO:0002376 immune system process
IEA biological_process
GO:0004672 protein kinase activity
IEA molecular_function
GO:0004672 protein kinase activity
IEA molecular_function
GO:0004672 protein kinase activity
IDA molecular_function
GO:0004672 protein kinase activity
TAS molecular_function
GO:0004672 protein kinase activity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IEA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IEA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IEA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IDA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IDA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
IEA molecular_function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
TAS molecular_function
GO:0005070 SH3/SH2 adaptor activity
TAS molecular_function
GO:0005080 protein kinase C binding
IEA molecular_function
GO:0005102 receptor binding
IEA molecular_function
GO:0005102 receptor binding
IPI molecular_function
GO:0005158 insulin receptor binding
IEA molecular_function
GO:0005178 integrin binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005524 ATP binding
IEA molecular_function
GO:0005524 ATP binding
IEA molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005739 mitochondrion
IEA cellular_component
GO:0005739 mitochondrion
IDA cellular_component
GO:0005743 mitochondrial inner membr
ane
IEA cellular_component
GO:0005743 mitochondrial inner membr
ane
IEA cellular_component
GO:0005743 mitochondrial inner membr
ane
IDA cellular_component
GO:0005764 lysosome
IDA cellular_component
GO:0005770 late endosome
IDA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005856 cytoskeleton
IEA cellular_component
GO:0005856 cytoskeleton
IEA cellular_component
GO:0005884 actin filament
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005901 caveola
IEA cellular_component
GO:0005901 caveola
IDA cellular_component
GO:0006468 protein phosphorylation
IEA biological_process
GO:0006468 protein phosphorylation
IEA biological_process
GO:0007049 cell cycle
IEA biological_process
GO:0007155 cell adhesion
IEA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007172 signal complex assembly
TAS biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
IEA biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
IBA biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
TAS biological_process
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
IMP biological_process
GO:0007229 integrin-mediated signali
ng pathway
IMP biological_process
GO:0007417 central nervous system de
velopment
IBA biological_process
GO:0008022 protein C-terminus bindin
g
IEA molecular_function
GO:0008283 cell proliferation
IEA biological_process
GO:0009612 response to mechanical st
imulus
IEA biological_process
GO:0009615 response to virus
IEA biological_process
GO:0010447 response to acidic pH
IEA biological_process
GO:0010628 positive regulation of ge
ne expression
IEA biological_process
GO:0010632 regulation of epithelial
cell migration
IMP biological_process
GO:0010634 positive regulation of ep
ithelial cell migration
IMP biological_process
GO:0010641 positive regulation of pl
atelet-derived growth fac
tor receptor signaling pa
thway
IEA biological_process
GO:0010907 positive regulation of gl
ucose metabolic process
IEA biological_process
GO:0014069 postsynaptic density
IEA cellular_component
GO:0014911 positive regulation of sm
ooth muscle cell migratio
n
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016032 viral process
IEA biological_process
GO:0016301 kinase activity
IEA molecular_function
GO:0016301 kinase activity
IEA molecular_function
GO:0016301 kinase activity
TAS molecular_function
GO:0016310 phosphorylation
IEA biological_process
GO:0016310 phosphorylation
IEA biological_process
GO:0016337 single organismal cell-ce
ll adhesion
IEA biological_process
GO:0016477 cell migration
IEA biological_process
GO:0016740 transferase activity
IEA molecular_function
GO:0018105 peptidyl-serine phosphory
lation
IEA biological_process
GO:0018108 peptidyl-tyrosine phospho
rylation
IEA biological_process
GO:0018108 peptidyl-tyrosine phospho
rylation
IDA biological_process
GO:0019899 enzyme binding
IEA molecular_function
GO:0019899 enzyme binding
IPI molecular_function
GO:0019900 kinase binding
IPI molecular_function
GO:0019901 protein kinase binding
IEA molecular_function
GO:0019904 protein domain specific b
inding
IEA molecular_function
GO:0020037 heme binding
IDA molecular_function
GO:0022407 regulation of cell-cell a
dhesion
IMP biological_process
GO:0030168 platelet activation
TAS biological_process
GO:0030331 estrogen receptor binding
IEA molecular_function
GO:0030520 intracellular estrogen re
ceptor signaling pathway
IBA biological_process
GO:0030900 forebrain development
IEA biological_process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IBA cellular_component
GO:0031295 T cell costimulation
TAS biological_process
GO:0031295 T cell costimulation
TAS biological_process
GO:0031648 protein destabilization
IEA biological_process
GO:0031667 response to nutrient leve
ls
IEA biological_process
GO:0031954 positive regulation of pr
otein autophosphorylation
IEA biological_process
GO:0032148 activation of protein kin
ase B activity
IEA biological_process
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
IMP biological_process
GO:0032403 protein complex binding
IEA molecular_function
GO:0032463 negative regulation of pr
otein homooligomerization
IMP biological_process
GO:0032587 ruffle membrane
IEA cellular_component
GO:0032869 cellular response to insu
lin stimulus
IEA biological_process
GO:0033146 regulation of intracellul
ar estrogen receptor sign
aling pathway
IEA biological_process
GO:0033625 positive regulation of in
tegrin activation
TAS biological_process
GO:0034332 adherens junction organiz
ation
IEA biological_process
GO:0034446 substrate adhesion-depend
ent cell spreading
IEA biological_process
GO:0034614 cellular response to reac
tive oxygen species
IEA biological_process
GO:0035556 intracellular signal tran
sduction
IEA biological_process
GO:0035556 intracellular signal tran
sduction
IDA biological_process
GO:0035556 intracellular signal tran
sduction
TAS biological_process
GO:0036035 osteoclast development
IEA biological_process
GO:0036035 osteoclast development
IBA biological_process
GO:0036120 cellular response to plat
elet-derived growth facto
r stimulus
IEA biological_process
GO:0038083 peptidyl-tyrosine autopho
sphorylation
IBA biological_process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
TAS biological_process
GO:0038128 ERBB2 signaling pathway
TAS biological_process
GO:0042127 regulation of cell prolif
eration
IBA biological_process
GO:0042169 SH2 domain binding
IPI molecular_function
GO:0042493 response to drug
IEA biological_process
GO:0042542 response to hydrogen pero
xide
IEA biological_process
GO:0043005 neuron projection
IEA cellular_component
GO:0043065 positive regulation of ap
optotic process
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IMP biological_process
GO:0043114 regulation of vascular pe
rmeability
TAS biological_process
GO:0043149 stress fiber assembly
IMP biological_process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
IMP biological_process
GO:0043393 regulation of protein bin
ding
IEA biological_process
GO:0043406 positive regulation of MA
P kinase activity
IEA biological_process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IEA biological_process
GO:0044325 ion channel binding
IEA molecular_function
GO:0044325 ion channel binding
IPI molecular_function
GO:0044325 ion channel binding
IPI molecular_function
GO:0045056 transcytosis
IEA biological_process
GO:0045087 innate immune response
IBA biological_process
GO:0045124 regulation of bone resorp
tion
TAS biological_process
GO:0045453 bone resorption
IEA biological_process
GO:0045453 bone resorption
ISS biological_process
GO:0045737 positive regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
IEA biological_process
GO:0045785 positive regulation of ce
ll adhesion
IEA biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IEA biological_process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
IEA biological_process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
IEA biological_process
GO:0046777 protein autophosphorylati
on
IEA biological_process
GO:0046777 protein autophosphorylati
on
IDA biological_process
GO:0046875 ephrin receptor binding
IEA molecular_function
GO:0046875 ephrin receptor binding
IPI molecular_function
GO:0048008 platelet-derived growth f
actor receptor signaling
pathway
IBA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048011 neurotrophin TRK receptor
signaling pathway
IEA biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0048471 perinuclear region of cyt
oplasm
IEA cellular_component
GO:0048477 oogenesis
IEA biological_process
GO:0050715 positive regulation of cy
tokine secretion
IEA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IC biological_process
GO:0050839 cell adhesion molecule bi
nding
IEA molecular_function
GO:0050847 progesterone receptor sig
naling pathway
IEA biological_process
GO:0050847 progesterone receptor sig
naling pathway
ISS biological_process
GO:0050847 progesterone receptor sig
naling pathway
IBA biological_process
GO:0050900 leukocyte migration
TAS biological_process
GO:0051219 phosphoprotein binding
IPI molecular_function
GO:0051222 positive regulation of pr
otein transport
IEA biological_process
GO:0051385 response to mineralocorti
coid
IEA biological_process
GO:0051427 hormone receptor binding
IBA molecular_function
GO:0051602 response to electrical st
imulus
IEA biological_process
GO:0051726 regulation of cell cycle
IBA biological_process
GO:0051895 negative regulation of fo
cal adhesion assembly
IEA biological_process
GO:0051895 negative regulation of fo
cal adhesion assembly
ISS biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IMP biological_process
GO:0051902 negative regulation of mi
tochondrial depolarizatio
n
IMP biological_process
GO:0051974 negative regulation of te
lomerase activity
IMP biological_process
GO:0060065 uterus development
IEA biological_process
GO:0060444 branching involved in mam
mary gland duct morphogen
esis
IEA biological_process
GO:0060491 regulation of cell projec
tion assembly
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological_process
GO:0070542 response to fatty acid
IEA biological_process
GO:0070555 response to interleukin-1
IMP biological_process
GO:0070851 growth factor receptor bi
nding
IPI molecular_function
GO:0071222 cellular response to lipo
polysaccharide
IEA biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
IEA biological_process
GO:0071375 cellular response to pept
ide hormone stimulus
ISS biological_process
GO:0071393 cellular response to prog
esterone stimulus
IEA biological_process
GO:0071393 cellular response to prog
esterone stimulus
ISS biological_process
GO:0071398 cellular response to fatt
y acid
IEA biological_process
GO:0071456 cellular response to hypo
xia
IEA biological_process
GO:0071498 cellular response to flui
d shear stress
IEA biological_process
GO:0071560 cellular response to tran
sforming growth factor be
ta stimulus
IEA biological_process
GO:0071801 regulation of podosome as
sembly
IBA biological_process
GO:0071803 positive regulation of po
dosome assembly
IEA biological_process
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
IEA biological_process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
ISS biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IEA biological_process
GO:0097110 scaffold protein binding
IEA molecular_function
GO:0097110 scaffold protein binding
IPI molecular_function
GO:1902533 positive regulation of in
tracellular signal transd
uction
IEA biological_process
GO:2000394 positive regulation of la
mellipodium morphogenesis
IMP biological_process
GO:2000573 positive regulation of DN
A biosynthetic process
IEA biological_process
GO:2000641 regulation of early endos
ome to late endosome tran
sport
IMP biological_process
GO:2000811 negative regulation of an
oikis
IMP biological_process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
IMP biological_process
GO:2001243 negative regulation of in
trinsic apoptotic signali
ng pathway
IMP biological_process
GO:2001286 regulation of caveolin-me
diated endocytosis
IMP biological_process
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
TAS biological_process
GO:0004672 protein kinase activity
IDA molecular_function
GO:0004672 protein kinase activity
TAS molecular_function
GO:0004672 protein kinase activity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IDA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
IDA molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
EXP molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular_function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
TAS molecular_function
GO:0005070 SH3/SH2 adaptor activity
TAS molecular_function
GO:0005102 receptor binding
IPI molecular_function
GO:0005178 integrin binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005739 mitochondrion
IDA cellular_component
GO:0005743 mitochondrial inner membr
ane
IDA cellular_component
GO:0005764 lysosome
IDA cellular_component
GO:0005770 late endosome
IDA cellular_component
GO:0005829 cytosol
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005901 caveola
IDA cellular_component
GO:0007165 signal transduction
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007172 signal complex assembly
TAS biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
IBA biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
TAS biological_process
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
IMP biological_process
GO:0007229 integrin-mediated signali
ng pathway
IMP biological_process
GO:0007417 central nervous system de
velopment
IBA biological_process
GO:0010632 regulation of epithelial
cell migration
IMP biological_process
GO:0010634 positive regulation of ep
ithelial cell migration
IMP biological_process
GO:0016301 kinase activity
TAS molecular_function
GO:0018108 peptidyl-tyrosine phospho
rylation
IDA biological_process
GO:0019899 enzyme binding
IPI molecular_function
GO:0019900 kinase binding
IPI molecular_function
GO:0020037 heme binding
IDA molecular_function
GO:0022407 regulation of cell-cell a
dhesion
IMP biological_process
GO:0030168 platelet activation
TAS biological_process
GO:0030520 intracellular estrogen re
ceptor signaling pathway
IBA biological_process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
IBA cellular_component
GO:0031295 T cell costimulation
TAS biological_process
GO:0031295 T cell costimulation
TAS biological_process
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
IMP biological_process
GO:0032463 negative regulation of pr
otein homooligomerization
IMP biological_process
GO:0033625 positive regulation of in
tegrin activation
TAS biological_process
GO:0035556 intracellular signal tran
sduction
IDA biological_process
GO:0035556 intracellular signal tran
sduction
TAS biological_process
GO:0036035 osteoclast development
IBA biological_process
GO:0038083 peptidyl-tyrosine autopho
sphorylation
IBA biological_process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
TAS biological_process
GO:0038128 ERBB2 signaling pathway
TAS biological_process
GO:0042127 regulation of cell prolif
eration
IBA biological_process
GO:0042169 SH2 domain binding
IPI molecular_function
GO:0043066 negative regulation of ap
optotic process
IMP biological_process
GO:0043114 regulation of vascular pe
rmeability
TAS biological_process
GO:0043149 stress fiber assembly
IMP biological_process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
IMP biological_process
GO:0044325 ion channel binding
IPI molecular_function
GO:0044325 ion channel binding
IPI molecular_function
GO:0045087 innate immune response
IBA biological_process
GO:0045124 regulation of bone resorp
tion
TAS biological_process
GO:0045453 bone resorption
ISS biological_process
GO:0046777 protein autophosphorylati
on
IDA biological_process
GO:0046875 ephrin receptor binding
IPI molecular_function
GO:0048008 platelet-derived growth f
actor receptor signaling
pathway
IBA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0048013 ephrin receptor signaling
pathway
TAS biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IC biological_process
GO:0050847 progesterone receptor sig
naling pathway
ISS biological_process
GO:0050847 progesterone receptor sig
naling pathway
IBA biological_process
GO:0050900 leukocyte migration
TAS biological_process
GO:0051219 phosphoprotein binding
IPI molecular_function
GO:0051427 hormone receptor binding
IBA molecular_function
GO:0051726 regulation of cell cycle
IBA biological_process
GO:0051895 negative regulation of fo
cal adhesion assembly
ISS biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IMP biological_process
GO:0051902 negative regulation of mi
tochondrial depolarizatio
n
IMP biological_process
GO:0051974 negative regulation of te
lomerase activity
IMP biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070555 response to interleukin-1
IMP biological_process
GO:0070851 growth factor receptor bi
nding
IPI molecular_function
GO:0071375 cellular response to pept
ide hormone stimulus
ISS biological_process
GO:0071393 cellular response to prog
esterone stimulus
ISS biological_process
GO:0071801 regulation of podosome as
sembly
IBA biological_process
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
IDA biological_process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
ISS biological_process
GO:0097110 scaffold protein binding
IPI molecular_function
GO:2000394 positive regulation of la
mellipodium morphogenesis
IMP biological_process
GO:2000641 regulation of early endos
ome to late endosome tran
sport
IMP biological_process
GO:2000811 negative regulation of an
oikis
IMP biological_process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
IMP biological_process
GO:2001243 negative regulation of in
trinsic apoptotic signali
ng pathway
IMP biological_process
GO:2001286 regulation of caveolin-me
diated endocytosis
IMP biological_process

KEGG pathways

hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05152  Tuberculosis
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05203  Viral carcinogenesis
hsa04144  Endocytosis
hsa01522  Endocrine resistance
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04919  Thyroid hormone signaling pathway
hsa04360  Axon guidance
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04012  ErbB signaling pathway
hsa04520  Adherens junction
hsa05219  Bladder cancer
hsa04611  Platelet activation
hsa04540  Gap junction
hsa04921  Oxytocin signaling pathway
hsa04912  GnRH signaling pathway
hsa04530  Tight junction
hsa04370  VEGF signaling pathway
PTHR24418:SF53  Integrin signalling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04137  Mitophagy - animal
hsa05131  Shigellosis
hsa04727  GABAergic synapse
PTHR24418:SF53  Integrin signalling pathway
PTHR24418:SF53  CCKR signaling map
PTHR24418:SF53  CCKR signaling map
PTHR24418:SF53  Angiogenesis
PTHR24418:SF53  Angiogenesis
PTHR24418:SF53  Cadherin signaling pathway
PTHR24418:SF53  Cadherin signaling pathway

Diseases

Associated diseases References
Endometriosis PMID: 22772552
Male infertility PMID: 23397631
Endometriosis INFBASE22772552
Ovarian endometriosis INFBASE21518137
Ovarian endometriosis INFBASE20155281
Endometriosis (ovarian) INFBASE20155281
Ovarian endometriosis PMID: 21518137
Ovarian endometriosis PMID: 21518137
Ovarian endometriosis PMID: 20155281
Thrombocytopenia KEGG: H00978

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24972189 Endometrio
sis



Show abstract
22772552 Endometrio
sis


SRC-1
Show abstract
21518137 Endometrio
sis (ovari
an)


SRC-1
transitional intermediary factor 2 (TIF2)
SRC-3
and ER
Show abstract
20155281 Endometrio
sis (ovari
an)

74 ( 37 cases o
f endometriotic
epithelia, 37
eutopic endomet
ria of identica
l patients)
SRC-1
Show abstract