Endometriosis Knowledgebase

Search Result

Gene id

6714

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SRC Gene UCSC Ensembl

Aliases

ASV, SRC1, THC6, c-SRC, p60-Src

Gene name

SRC proto-oncogene, non-receptor tyrosine kinase

Alternate names

proto-oncogene tyrosine-protein kinase Src, proto-oncogene c-Src, protooncogene SRC, Rous sarcoma, tyrosine kinase pp60c-src, tyrosine-protein kinase SRC-1, v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog,

Gene location

20q11.23 (37344684: 37405431) Exons: 17 NC_000020.11

Gene summary(Entrez)

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

190090

Protein Summary

Protein general information

P12931

Name: Proto oncogene tyrosine protein kinase Src (EC 2.7.10.2) (Proto oncogene c Src) (pp60c src) (p60 Src)

Length: 536 Mass: 59,835

Tissue specificity: Expressed ubiquitously. Platelets, neurons and osteoclasts express 5-fold to 200-fold higher levels than most other tissues.

Sequence

MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTS
PQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEE
WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNS
LQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIAS
GMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWS
FGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTS
TEPQYQPGENL

Structural information

Protein Domains	SH3. (84-145) SH2. (151-248) Protein (270-523)
Interpro:	IPR011009 IPR000719 IPR017441 IPR001245 IPR000980 IPR001452 IPR008266 IPR020635
Prosite:	PS00107 PS50011 PS00109 PS50001 PS50002
Pfam:	PF07714 PF00017 PF00018
PDB:	1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ
PDBsum:	1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ
DIP:	1059
MINT:	93621
STRING:	ENSP00000350941;

Other Databases

GeneCards: SRC; Malacards: SRC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0005070	SH3/SH2 adaptor activity	TAS	molecular_function
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005158	insulin receptor binding	IEA	molecular_function
GO:0005178	integrin binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005884	actin filament	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0007049	cell cycle	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007172	signal complex assembly	TAS	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IBA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0007417	central nervous system de velopment	IBA	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009615	response to virus	IEA	biological_process
GO:0010447	response to acidic pH	IEA	biological_process
GO:0010632	regulation of epithelial cell migration	IMP	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IMP	biological_process
GO:0010641	positive regulation of pl atelet-derived growth fac tor receptor signaling pa thway	IEA	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IEA	biological_process
GO:0014069	postsynaptic density	IEA	cellular_component
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016301	kinase activity	TAS	molecular_function
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019900	kinase binding	IPI	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0022407	regulation of cell-cell a dhesion	IMP	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030331	estrogen receptor binding	IEA	molecular_function
GO:0030520	intracellular estrogen re ceptor signaling pathway	IBA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031648	protein destabilization	IEA	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0031954	positive regulation of pr otein autophosphorylation	IEA	biological_process
GO:0032148	activation of protein kin ase B activity	IEA	biological_process
GO:0032211	negative regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0032463	negative regulation of pr otein homooligomerization	IMP	biological_process
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0033146	regulation of intracellul ar estrogen receptor sign aling pathway	IEA	biological_process
GO:0033625	positive regulation of in tegrin activation	TAS	biological_process
GO:0034332	adherens junction organiz ation	IEA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IEA	biological_process
GO:0034614	cellular response to reac tive oxygen species	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0036035	osteoclast development	IBA	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043393	regulation of protein bin ding	IEA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IEA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IEA	biological_process
GO:0044325	ion channel binding	IPI	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045056	transcytosis	IEA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045124	regulation of bone resorp tion	TAS	biological_process
GO:0045453	bone resorption	ISS	biological_process
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0048008	platelet-derived growth f actor receptor signaling pathway	IBA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	IEA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048477	oogenesis	IEA	biological_process
GO:0050715	positive regulation of cy tokine secretion	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IC	biological_process
GO:0050847	progesterone receptor sig naling pathway	ISS	biological_process
GO:0050847	progesterone receptor sig naling pathway	IBA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051219	phosphoprotein binding	IPI	molecular_function
GO:0051385	response to mineralocorti coid	IEA	biological_process
GO:0051427	hormone receptor binding	IBA	molecular_function
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0051726	regulation of cell cycle	IBA	biological_process
GO:0051895	negative regulation of fo cal adhesion assembly	ISS	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051902	negative regulation of mi tochondrial depolarizatio n	IMP	biological_process
GO:0051974	negative regulation of te lomerase activity	IMP	biological_process
GO:0060065	uterus development	IEA	biological_process
GO:0060444	branching involved in mam mary gland duct morphogen esis	IEA	biological_process
GO:0060491	regulation of cell projec tion assembly	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070555	response to interleukin-1	IMP	biological_process
GO:0070851	growth factor receptor bi nding	IPI	molecular_function
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	ISS	biological_process
GO:0071393	cellular response to prog esterone stimulus	ISS	biological_process
GO:0071398	cellular response to fatt y acid	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071498	cellular response to flui d shear stress	IEA	biological_process
GO:0071801	regulation of podosome as sembly	IBA	biological_process
GO:0071803	positive regulation of po dosome assembly	IEA	biological_process
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0086098	angiotensin-activated sig naling pathway involved i n heart process	ISS	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:2000394	positive regulation of la mellipodium morphogenesis	IMP	biological_process
GO:2000573	positive regulation of DN A biosynthetic process	IEA	biological_process
GO:2000641	regulation of early endos ome to late endosome tran sport	IMP	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001286	regulation of caveolin-me diated endocytosis	IMP	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	IEA	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0005070	SH3/SH2 adaptor activity	TAS	molecular_function
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005158	insulin receptor binding	IEA	molecular_function
GO:0005178	integrin binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005884	actin filament	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005901	caveola	IEA	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007172	signal complex assembly	TAS	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IBA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0007417	central nervous system de velopment	IBA	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009615	response to virus	IEA	biological_process
GO:0010447	response to acidic pH	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010632	regulation of epithelial cell migration	IMP	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IMP	biological_process
GO:0010641	positive regulation of pl atelet-derived growth fac tor receptor signaling pa thway	IEA	biological_process
GO:0010907	positive regulation of gl ucose metabolic process	IEA	biological_process
GO:0014069	postsynaptic density	IEA	cellular_component
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	TAS	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016310	phosphorylation	IEA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0016477	cell migration	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019900	kinase binding	IPI	molecular_function
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0022407	regulation of cell-cell a dhesion	IMP	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030331	estrogen receptor binding	IEA	molecular_function
GO:0030520	intracellular estrogen re ceptor signaling pathway	IBA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031648	protein destabilization	IEA	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0031954	positive regulation of pr otein autophosphorylation	IEA	biological_process
GO:0032148	activation of protein kin ase B activity	IEA	biological_process
GO:0032211	negative regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032463	negative regulation of pr otein homooligomerization	IMP	biological_process
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0033146	regulation of intracellul ar estrogen receptor sign aling pathway	IEA	biological_process
GO:0033625	positive regulation of in tegrin activation	TAS	biological_process
GO:0034332	adherens junction organiz ation	IEA	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IEA	biological_process
GO:0034614	cellular response to reac tive oxygen species	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0036035	osteoclast development	IEA	biological_process
GO:0036035	osteoclast development	IBA	biological_process
GO:0036120	cellular response to plat elet-derived growth facto r stimulus	IEA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0043393	regulation of protein bin ding	IEA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IEA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IEA	biological_process
GO:0044325	ion channel binding	IEA	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045056	transcytosis	IEA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045124	regulation of bone resorp tion	TAS	biological_process
GO:0045453	bone resorption	IEA	biological_process
GO:0045453	bone resorption	ISS	biological_process
GO:0045737	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0046628	positive regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046777	protein autophosphorylati on	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046875	ephrin receptor binding	IEA	molecular_function
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0048008	platelet-derived growth f actor receptor signaling pathway	IBA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	IEA	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048477	oogenesis	IEA	biological_process
GO:0050715	positive regulation of cy tokine secretion	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IC	biological_process
GO:0050839	cell adhesion molecule bi nding	IEA	molecular_function
GO:0050847	progesterone receptor sig naling pathway	IEA	biological_process
GO:0050847	progesterone receptor sig naling pathway	ISS	biological_process
GO:0050847	progesterone receptor sig naling pathway	IBA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051219	phosphoprotein binding	IPI	molecular_function
GO:0051222	positive regulation of pr otein transport	IEA	biological_process
GO:0051385	response to mineralocorti coid	IEA	biological_process
GO:0051427	hormone receptor binding	IBA	molecular_function
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0051726	regulation of cell cycle	IBA	biological_process
GO:0051895	negative regulation of fo cal adhesion assembly	IEA	biological_process
GO:0051895	negative regulation of fo cal adhesion assembly	ISS	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051902	negative regulation of mi tochondrial depolarizatio n	IMP	biological_process
GO:0051974	negative regulation of te lomerase activity	IMP	biological_process
GO:0060065	uterus development	IEA	biological_process
GO:0060444	branching involved in mam mary gland duct morphogen esis	IEA	biological_process
GO:0060491	regulation of cell projec tion assembly	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070542	response to fatty acid	IEA	biological_process
GO:0070555	response to interleukin-1	IMP	biological_process
GO:0070851	growth factor receptor bi nding	IPI	molecular_function
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IEA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	ISS	biological_process
GO:0071393	cellular response to prog esterone stimulus	IEA	biological_process
GO:0071393	cellular response to prog esterone stimulus	ISS	biological_process
GO:0071398	cellular response to fatt y acid	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071498	cellular response to flui d shear stress	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0071801	regulation of podosome as sembly	IBA	biological_process
GO:0071803	positive regulation of po dosome assembly	IEA	biological_process
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0086098	angiotensin-activated sig naling pathway involved i n heart process	IEA	biological_process
GO:0086098	angiotensin-activated sig naling pathway involved i n heart process	ISS	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0097110	scaffold protein binding	IEA	molecular_function
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:1902533	positive regulation of in tracellular signal transd uction	IEA	biological_process
GO:2000394	positive regulation of la mellipodium morphogenesis	IMP	biological_process
GO:2000573	positive regulation of DN A biosynthetic process	IEA	biological_process
GO:2000641	regulation of early endos ome to late endosome tran sport	IMP	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001286	regulation of caveolin-me diated endocytosis	IMP	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004715	non-membrane spanning pro tein tyrosine kinase acti vity	TAS	molecular_function
GO:0005070	SH3/SH2 adaptor activity	TAS	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005178	integrin binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005770	late endosome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005901	caveola	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007172	signal complex assembly	TAS	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IBA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0007417	central nervous system de velopment	IBA	biological_process
GO:0010632	regulation of epithelial cell migration	IMP	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IMP	biological_process
GO:0016301	kinase activity	TAS	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019900	kinase binding	IPI	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0022407	regulation of cell-cell a dhesion	IMP	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030520	intracellular estrogen re ceptor signaling pathway	IBA	biological_process
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IBA	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031295	T cell costimulation	TAS	biological_process
GO:0032211	negative regulation of te lomere maintenance via te lomerase	IMP	biological_process
GO:0032463	negative regulation of pr otein homooligomerization	IMP	biological_process
GO:0033625	positive regulation of in tegrin activation	TAS	biological_process
GO:0035556	intracellular signal tran sduction	IDA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0036035	osteoclast development	IBA	biological_process
GO:0038083	peptidyl-tyrosine autopho sphorylation	IBA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IMP	biological_process
GO:0044325	ion channel binding	IPI	molecular_function
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045087	innate immune response	IBA	biological_process
GO:0045124	regulation of bone resorp tion	TAS	biological_process
GO:0045453	bone resorption	ISS	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0048008	platelet-derived growth f actor receptor signaling pathway	IBA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	TAS	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IC	biological_process
GO:0050847	progesterone receptor sig naling pathway	ISS	biological_process
GO:0050847	progesterone receptor sig naling pathway	IBA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051219	phosphoprotein binding	IPI	molecular_function
GO:0051427	hormone receptor binding	IBA	molecular_function
GO:0051726	regulation of cell cycle	IBA	biological_process
GO:0051895	negative regulation of fo cal adhesion assembly	ISS	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051902	negative regulation of mi tochondrial depolarizatio n	IMP	biological_process
GO:0051974	negative regulation of te lomerase activity	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070555	response to interleukin-1	IMP	biological_process
GO:0070851	growth factor receptor bi nding	IPI	molecular_function
GO:0071375	cellular response to pept ide hormone stimulus	ISS	biological_process
GO:0071393	cellular response to prog esterone stimulus	ISS	biological_process
GO:0071801	regulation of podosome as sembly	IBA	biological_process
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0086098	angiotensin-activated sig naling pathway involved i n heart process	ISS	biological_process
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:2000394	positive regulation of la mellipodium morphogenesis	IMP	biological_process
GO:2000641	regulation of early endos ome to late endosome tran sport	IMP	biological_process
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001243	negative regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001286	regulation of caveolin-me diated endocytosis	IMP	biological_process

KEGG pathways

hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04510  Focal adhesion
hsa05152  Tuberculosis
hsa05418  Fluid shear stress and atherosclerosis
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05203  Viral carcinogenesis
hsa04144  Endocytosis
hsa01522  Endocrine resistance
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04919  Thyroid hormone signaling pathway
hsa04360  Axon guidance
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04012  ErbB signaling pathway
hsa04520  Adherens junction
hsa05219  Bladder cancer
hsa04611  Platelet activation
hsa04540  Gap junction
hsa04921  Oxytocin signaling pathway
hsa04912  GnRH signaling pathway
hsa04530  Tight junction
hsa04370  VEGF signaling pathway
PTHR24418:SF53  Integrin signalling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04137  Mitophagy - animal
hsa05131  Shigellosis
hsa04727  GABAergic synapse
PTHR24418:SF53  Integrin signalling pathway
PTHR24418:SF53  CCKR signaling map
PTHR24418:SF53  CCKR signaling map
PTHR24418:SF53  Angiogenesis
PTHR24418:SF53  Angiogenesis
PTHR24418:SF53  Cadherin signaling pathway
PTHR24418:SF53  Cadherin signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 22772552
Male infertility	PMID: 23397631
Endometriosis	INFBASE22772552
Ovarian endometriosis	INFBASE21518137
Ovarian endometriosis	INFBASE20155281
Endometriosis (ovarian)	INFBASE20155281
Ovarian endometriosis	PMID: 21518137
Ovarian endometriosis	PMID: 21518137
Ovarian endometriosis	PMID: 20155281
Thrombocytopenia	KEGG: H00978

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
24972189	Endometrio sis			Show abstract
22772552	Endometrio sis		SRC-1	Show abstract
21518137	Endometrio sis (ovari an)		SRC-1 transitional intermediary factor 2 (TIF2) SRC-3 and ER	Show abstract
20155281	Endometrio sis (ovari an)	74 ( 37 cases o f endometriotic epithelia, 37 eutopic endomet ria of identica l patients)	SRC-1	Show abstract