Endometriosis Knowledgebase

Search Result

Gene id

672

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

BRCA1 Gene UCSC Ensembl

Aliases

BRCAI, BRCC1, BROVCA1, FANCS, IRIS, PNCA4, PPP1R53, PSCP, RNF53

Gene name

BRCA1, DNA repair associated

Alternate names

breast cancer type 1 susceptibility protein, BRCA1/BRCA2-containing complex, subunit 1, Fanconi anemia, complementation group S, RING finger protein 53, breast and ovarian cancer susceptibility protein 1, breast cancer 1, early onset, early onset breast cancer ,

Gene location

17q21.31 (43125482: 43044294) Exons: 24 NC_000017.11

Gene summary(Entrez)

This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. [provided by RefSeq, May 2009]

OMIM

113705

Protein Summary

Protein general information

P38398

Name: Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING type E3 ubiquitin transferase BRCA1)

Length: 1863 Mass: 207,721

Tissue specificity: Isoform 1 and isoform 3 are widely expressed. Isoform 3 is reduced or absent in several breast and ovarian cancer cell lines.

Sequence

MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQE
STRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQET
SLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAA
CEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITL
NSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSK
SVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAV
QKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPA
TGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDL
MLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRND
TEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQ
NPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSS
TNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFS
PYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVI
LAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTG
LEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQP
SNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDP
ESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRM
SMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKE
RKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY

Structural information

Protein Domains	BRCT (1642-1736) BRCT (1756-1855)
Interpro:	IPR011364 IPR031099 IPR025994 IPR001357 IPR018957 IPR001841 IPR013083 IPR017907
Prosite:	PS50172 PS00518 PS50089
Pfam:	PF00533 PF12820 PF00097
CDD:	cd00027 cd00162
PDB:	1JM7 1JNX 1N5O 1OQA 1T15 1T29 1T2U 1T2V 1Y98 2ING 3COJ 3K0H 3K0K 3K15 3K16 3PXA 3PXB 3PXC 3PXD 3PXE 4IFI 4IGK 4JLU 4OFB 4U4A 4Y18 4Y2G
PDBsum:	1JM7 1JNX 1N5O 1OQA 1T15 1T29 1T2U 1T2V 1Y98 2ING 3COJ 3K0H 3K0K 3K15 3K16 3PXA 3PXB 3PXC 3PXD 3PXE 4IFI 4IGK 4JLU 4OFB 4U4A 4Y18 4Y2G
DIP:	5971
MINT:	90433
STRING:	ENSP00000418960;

Other Databases

GeneCards: BRCA1; Malacards: BRCA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000151	ubiquitin ligase complex	NAS	cellular_component
GO:0000724	double-strand break repai r via homologous recombin ation	IDA	biological_process
GO:0000729	DNA double-strand break p rocessing	TAS	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0000794	condensed nuclear chromos ome	IEA	cellular_component
GO:0003677	DNA binding	TAS	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003684	damaged DNA binding	IEA	molecular_function
GO:0003713	transcription coactivator activity	NAS	molecular_function
GO:0003723	RNA binding	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005694	chromosome	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005759	mitochondrial matrix	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006260	DNA replication	TAS	biological_process
GO:0006301	postreplication repair	IDA	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IDA	biological_process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological_process
GO:0006349	regulation of gene expres sion by genetic imprintin g	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006359	regulation of transcripti on from RNA polymerase II I promoter	TAS	biological_process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	TAS	biological_process
GO:0007059	chromosome segregation	IMP	biological_process
GO:0007098	centrosome cycle	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008274	gamma-tubulin ring comple x	NAS	cellular_component
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological_process
GO:0009048	dosage compensation by in activation of X chromosom e	IBA	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0015631	tubulin binding	NAS	molecular_function
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0016874	ligase activity	IEA	molecular_function
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030521	androgen receptor signali ng pathway	NAS	biological_process
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular_component
GO:0031052	chromosome breakage	IEA	biological_process
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological_process
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032355	response to estradiol	IEA	biological_process
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IMP	biological_process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological_process
GO:0035066	positive regulation of hi stone acetylation	IDA	biological_process
GO:0035067	negative regulation of hi stone acetylation	IBA	biological_process
GO:0042127	regulation of cell prolif eration	TAS	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043009	chordate embryonic develo pment	IBA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043627	response to estrogen	IDA	biological_process
GO:0044030	regulation of DNA methyla tion	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045717	negative regulation of fa tty acid biosynthetic pro cess	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	TAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046600	negative regulation of ce ntriole replication	NAS	biological_process
GO:0050681	androgen receptor binding	NAS	molecular_function
GO:0051571	positive regulation of hi stone H3-K4 methylation	IDA	biological_process
GO:0051572	negative regulation of hi stone H3-K4 methylation	IEA	biological_process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IDA	biological_process
GO:0051574	positive regulation of hi stone H3-K9 methylation	IEA	biological_process
GO:0051865	protein autoubiquitinatio n	IDA	biological_process
GO:0051865	protein autoubiquitinatio n	IDA	biological_process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IDA	biological_process
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IMP	biological_process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological_process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological_process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological_process
GO:2000378	negative regulation of re active oxygen species met abolic process	IMP	biological_process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IDA	biological_process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IDA	biological_process
GO:0000151	ubiquitin ligase complex	NAS	cellular_component
GO:0000724	double-strand break repai r via homologous recombin ation	IDA	biological_process
GO:0000729	DNA double-strand break p rocessing	TAS	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0000793	condensed chromosome	IEA	cellular_component
GO:0000794	condensed nuclear chromos ome	IEA	cellular_component
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	TAS	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003684	damaged DNA binding	IEA	molecular_function
GO:0003713	transcription coactivator activity	NAS	molecular_function
GO:0003723	RNA binding	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IEA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005694	chromosome	ISS	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005759	mitochondrial matrix	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006260	DNA replication	IEA	biological_process
GO:0006260	DNA replication	TAS	biological_process
GO:0006260	DNA replication	TAS	biological_process
GO:0006281	DNA repair	IEA	biological_process
GO:0006281	DNA repair	IEA	biological_process
GO:0006301	postreplication repair	IDA	biological_process
GO:0006302	double-strand break repai r	IEA	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IDA	biological_process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological_process
GO:0006310	DNA recombination	IEA	biological_process
GO:0006349	regulation of gene expres sion by genetic imprintin g	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006359	regulation of transcripti on from RNA polymerase II I promoter	TAS	biological_process
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	TAS	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007059	chromosome segregation	IMP	biological_process
GO:0007098	centrosome cycle	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0008274	gamma-tubulin ring comple x	NAS	cellular_component
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological_process
GO:0009048	dosage compensation by in activation of X chromosom e	IEA	biological_process
GO:0009048	dosage compensation by in activation of X chromosom e	IBA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0015631	tubulin binding	NAS	molecular_function
GO:0016567	protein ubiquitination	IEA	biological_process
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0016874	ligase activity	IEA	molecular_function
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030521	androgen receptor signali ng pathway	NAS	biological_process
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular_component
GO:0031052	chromosome breakage	IEA	biological_process
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological_process
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032355	response to estradiol	IEA	biological_process
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IMP	biological_process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological_process
GO:0033993	response to lipid	IEA	biological_process
GO:0035066	positive regulation of hi stone acetylation	IEA	biological_process
GO:0035066	positive regulation of hi stone acetylation	IDA	biological_process
GO:0035067	negative regulation of hi stone acetylation	IEA	biological_process
GO:0035067	negative regulation of hi stone acetylation	IBA	biological_process
GO:0042127	regulation of cell prolif eration	TAS	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043009	chordate embryonic develo pment	IEA	biological_process
GO:0043009	chordate embryonic develo pment	IBA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043627	response to estrogen	IDA	biological_process
GO:0044030	regulation of DNA methyla tion	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045717	negative regulation of fa tty acid biosynthetic pro cess	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	TAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046600	negative regulation of ce ntriole replication	NAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050681	androgen receptor binding	NAS	molecular_function
GO:0051571	positive regulation of hi stone H3-K4 methylation	IEA	biological_process
GO:0051571	positive regulation of hi stone H3-K4 methylation	IDA	biological_process
GO:0051572	negative regulation of hi stone H3-K4 methylation	IEA	biological_process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IEA	biological_process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IDA	biological_process
GO:0051574	positive regulation of hi stone H3-K9 methylation	IEA	biological_process
GO:0051865	protein autoubiquitinatio n	IDA	biological_process
GO:0051865	protein autoubiquitinatio n	IDA	biological_process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IEA	biological_process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IDA	biological_process
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IMP	biological_process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological_process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological_process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological_process
GO:2000378	negative regulation of re active oxygen species met abolic process	IMP	biological_process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IEA	biological_process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IDA	biological_process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IEA	biological_process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IDA	biological_process
GO:0000151	ubiquitin ligase complex	NAS	cellular_component
GO:0000724	double-strand break repai r via homologous recombin ation	IDA	biological_process
GO:0000729	DNA double-strand break p rocessing	TAS	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0003677	DNA binding	TAS	molecular_function
GO:0003713	transcription coactivator activity	NAS	molecular_function
GO:0003723	RNA binding	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005694	chromosome	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006260	DNA replication	TAS	biological_process
GO:0006301	postreplication repair	IDA	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006302	double-strand break repai r	IDA	biological_process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006359	regulation of transcripti on from RNA polymerase II I promoter	TAS	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	TAS	biological_process
GO:0007059	chromosome segregation	IMP	biological_process
GO:0008270	zinc ion binding	TAS	molecular_function
GO:0008274	gamma-tubulin ring comple x	NAS	cellular_component
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological_process
GO:0009048	dosage compensation by in activation of X chromosom e	IBA	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010212	response to ionizing radi ation	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0015631	tubulin binding	NAS	molecular_function
GO:0016567	protein ubiquitination	IDA	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030521	androgen receptor signali ng pathway	NAS	biological_process
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular_component
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological_process
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular_component
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031572	G2 DNA damage checkpoint	IMP	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IMP	biological_process
GO:0035066	positive regulation of hi stone acetylation	IDA	biological_process
GO:0035067	negative regulation of hi stone acetylation	IBA	biological_process
GO:0042127	regulation of cell prolif eration	TAS	biological_process
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043009	chordate embryonic develo pment	IBA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043627	response to estrogen	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045717	negative regulation of fa tty acid biosynthetic pro cess	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045739	positive regulation of DN A repair	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	TAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046600	negative regulation of ce ntriole replication	NAS	biological_process
GO:0050681	androgen receptor binding	NAS	molecular_function
GO:0051571	positive regulation of hi stone H3-K4 methylation	IDA	biological_process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IDA	biological_process
GO:0051865	protein autoubiquitinatio n	IDA	biological_process
GO:0051865	protein autoubiquitinatio n	IDA	biological_process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IDA	biological_process
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0070531	BRCA1-A complex	IDA	cellular_component
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IMP	biological_process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological_process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological_process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological_process
GO:2000378	negative regulation of re active oxygen species met abolic process	IMP	biological_process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IDA	biological_process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IDA	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05224  Breast cancer
hsa01524  Platinum drug resistance
hsa04120  Ubiquitin mediated proteolysis
hsa03460  Fanconi anemia pathway
hsa03440  Homologous recombination

Diseases

Associated diseases	References
Azoospermia	PMID: 19200961
Breast cancer	KEGG: H00031
Endometriosis	PMID: 25380576
Fallopian tube cancer	KEGG: H01554
Male infertility	PMID: 18270180
Meningomyelocele	PMID: 17640328
Oligoasthenoteratospermia	PMID: 18155199
Ovarian reserve	PMID: 25256924, KEGG: H00027
Peritoneal carcinoma	KEGG: H01665
Premature menopause	PMID: 16773440

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25380576	Endometrio sis	BRCA1 rs71361504 (-/GTT)	Indian	1063 (573 endom etriosis cases, 490 controls)			Show abstract
12568865	Endometrio sis	BrCA1 (T3232A)		7 women in two generations wi th familial end ometriosis		BrCA1 BrCA2 p53	Show abstract