Endometriosis Knowledgebase

Search Result

Gene id

6750

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SST Gene UCSC Ensembl

Aliases

SMST

Gene name

somatostatin

Alternate names

somatostatin, growth hormone release-inhibiting factor, prepro-somatostatin, somatostatin-14, somatostatin-28,

Gene location

3q27.3 (187670412: 187668905) Exons: 2 NC_000003.12

Gene summary(Entrez)

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. [provided by RefSeq, Jul 2008]

OMIM

182450

Protein Summary

Protein general information

P61278

Name: Somatostatin (Growth hormone release inhibiting factor) [Cleaved into: Somatostatin 28; Somatostatin 14]

Length: 116 Mass: 12,736

Sequence

MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQ
AAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC

Structural information

Interpro:	IPR004250 IPR018142
Pfam:	PF03002
PDB:	1P2W 2MI1
PDBsum:	1P2W 2MI1
STRING:	ENSP00000287641;

Other Databases

GeneCards: SST; Malacards: SST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005179	hormone activity	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006972	hyperosmotic response	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0007586	digestion	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0008628	hormone-mediated apoptoti c signaling pathway	TAS	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0010447	response to acidic pH	IEA	biological_process
GO:0030334	regulation of cell migrat ion	IBA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043200	response to amino acid	IEA	biological_process
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006972	hyperosmotic response	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0007586	digestion	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0008628	hormone-mediated apoptoti c signaling pathway	TAS	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010447	response to acidic pH	IEA	biological_process
GO:0030334	regulation of cell migrat ion	IEA	biological_process
GO:0030334	regulation of cell migrat ion	IBA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043200	response to amino acid	IEA	biological_process
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0005179	hormone activity	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0007586	digestion	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0008628	hormone-mediated apoptoti c signaling pathway	TAS	biological_process
GO:0030334	regulation of cell migrat ion	IBA	biological_process

KEGG pathways

hsa04971 Gastric acid secretion

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 17987251
Cancer	PMID: 16606630
Endometriosis	PMID: 20739383
Endometriosis	INFBASE24292148

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24292148	Endometrio sis			47 (Microarray study: 10 infer tile women with endometriosis, 5 fertile cont rols; qRT-PCR ( 27 infertile wo men with endome triosis, 15 fer tile controls))			Show abstract