Endometriosis Knowledgebase

Search Result

Gene id

6751

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SSTR1 Gene UCSC Ensembl

Aliases

SRIF-2, SS-1-R, SS1-R, SS1R

Gene name

somatostatin receptor 1

Alternate names

somatostatin receptor type 1,

Gene location

14q21.1 (38207998: 38213062) Exons: 3 NC_000014.9

Gene summary(Entrez)

Somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of many hormones and other secretory proteins. Somatostatin has two active forms of 14 and 28 amino acids. The biological effects of somatostatins are mediated by a family of G-protein coupled somatostatin receptors that are expressed in a tissue-specific manner. The protein encoded by this gene is a member of the superfamily of somatostatin receptors having seven transmembrane segments. Somatostatin receptors form homodimers and heterodimers with other members of the superfamily as well as with other G-protein coupled receptors and receptor tyrosine kinases. This somatostatin receptor has greater affinity for somatostatin-14 than -28. [provided by RefSeq, Jul 2012]

OMIM

182451

Protein Summary

Protein general information

P30872

Name: Somatostatin receptor type 1 (SS 1 R) (SS1 R) (SS1R) (SRIF 2)

Length: 391 Mass: 42,686

Tissue specificity: Fetal kidney, fetal liver, and adult pancreas, brain, lung, jejunum and stomach.

Sequence

MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCG
NSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTV
LSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVL
YTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLES
GGVFRNGTCTSRITTL

Structural information

Interpro:	IPR000276 IPR017452 IPR000586 IPR001116
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000267377;

Other Databases

GeneCards: SSTR1; Malacards: SSTR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004994	somatostatin receptor act ivity	IDA	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007215	glutamate receptor signal ing pathway	IEA	biological_process
GO:0007218	neuropeptide signaling pa thway	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0007586	digestion	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0021549	cerebellum development	IEA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0038170	somatostatin signaling pa thway	IEA	biological_process
GO:0042594	response to starvation	IEA	biological_process
GO:0042923	neuropeptide binding	IBA	molecular_function
GO:0043005	neuron projection	IBA	cellular_component
GO:0071392	cellular response to estr adiol stimulus	IBA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004994	somatostatin receptor act ivity	IEA	molecular_function
GO:0004994	somatostatin receptor act ivity	IEA	molecular_function
GO:0004994	somatostatin receptor act ivity	IDA	molecular_function
GO:0004994	somatostatin receptor act ivity	TAS	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007215	glutamate receptor signal ing pathway	IEA	biological_process
GO:0007218	neuropeptide signaling pa thway	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0007283	spermatogenesis	IEA	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0007586	digestion	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0021549	cerebellum development	IEA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0038170	somatostatin signaling pa thway	IEA	biological_process
GO:0042594	response to starvation	IEA	biological_process
GO:0042923	neuropeptide binding	IBA	molecular_function
GO:0043005	neuron projection	IBA	cellular_component
GO:0071392	cellular response to estr adiol stimulus	IEA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IBA	biological_process
GO:0004994	somatostatin receptor act ivity	IDA	molecular_function
GO:0004994	somatostatin receptor act ivity	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0007584	response to nutrient	TAS	biological_process
GO:0007586	digestion	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0042923	neuropeptide binding	IBA	molecular_function
GO:0043005	neuron projection	IBA	cellular_component
GO:0071392	cellular response to estr adiol stimulus	IBA	biological_process

KEGG pathways

hsa04080 Neuroactive ligand-receptor interaction
hsa04024 cAMP signaling pathway

Diseases

Associated diseases	References
Cancer	PMID: 16214911
Endometriosis	PMID: 20739383
Endometriosis	INFBASE20739383

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20739383	Endometrio sis			20 (15 patients affected by en dometriosis, 5 without endomet riosis)		sst1	Show abstract