Endometriosis Knowledgebase

Search Result

Gene id

6755

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SSTR5 Gene UCSC Ensembl

Aliases

SS-5-R

Gene name

somatostatin receptor 5

Alternate names

somatostatin receptor type 5, somatostatin receptor subtype 5,

Gene location

16p13.3 (1072755: 1081453) Exons: 2 NC_000016.10

Gene summary(Entrez)

Somatostatin and its related peptide cortistatin exert multiple biological actions on normal and tumoral tissue targets by interacting with somatostatin receptors (SSTRs). The protein encoded by this gene is one of the SSTRs, which is a multi-pass membrane protein and belongs to the G-protein coupled receptor 1 family. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase, and different regions of this receptor molecule are required for the activation of different signaling pathways. A mutation in this gene results in somatostatin analog resistance. Alternatively spliced transcript variants have been identified in this gene.[provided by RefSeq, Feb 2010]

OMIM

182455

Protein Summary

Protein general information

P35346

Name: Somatostatin receptor type 5 (SS 5 R) (SS5 R) (SS5R)

Length: 364 Mass: 39,202

Tissue specificity: Adult pituitary gland, heart, small intestine, adrenal gland, cerebellum and fetal hypothalamus. No expression in fetal or adult kidney, liver, pancreas, uterus, spleen, lung, thyroid or ovary. {ECO

Sequence

MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVT
NIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARW
RRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIV
VKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL

Structural information

Interpro:	IPR000276 IPR017452 IPR000586 IPR001184
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000293897;

Other Databases

GeneCards: SSTR5; Malacards: SSTR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004994	somatostatin receptor act ivity	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007193	adenylate cyclase-inhibit ing G-protein coupled rec eptor signaling pathway	IEA	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0038170	somatostatin signaling pa thway	IEA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042923	neuropeptide binding	IBA	molecular_function
GO:0043005	neuron projection	IBA	cellular_component
GO:0050796	regulation of insulin sec retion	IBA	biological_process
GO:0071385	cellular response to gluc ocorticoid stimulus	IBA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004994	somatostatin receptor act ivity	IEA	molecular_function
GO:0004994	somatostatin receptor act ivity	IEA	molecular_function
GO:0004994	somatostatin receptor act ivity	TAS	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007193	adenylate cyclase-inhibit ing G-protein coupled rec eptor signaling pathway	IEA	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0038170	somatostatin signaling pa thway	IEA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042923	neuropeptide binding	IBA	molecular_function
GO:0043005	neuron projection	IBA	cellular_component
GO:0050796	regulation of insulin sec retion	IEA	biological_process
GO:0050796	regulation of insulin sec retion	IBA	biological_process
GO:0071385	cellular response to gluc ocorticoid stimulus	IEA	biological_process
GO:0071385	cellular response to gluc ocorticoid stimulus	IBA	biological_process
GO:0004994	somatostatin receptor act ivity	TAS	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0032467	positive regulation of cy tokinesis	IMP	biological_process
GO:0042923	neuropeptide binding	IBA	molecular_function
GO:0043005	neuron projection	IBA	cellular_component
GO:0050796	regulation of insulin sec retion	IBA	biological_process
GO:0071385	cellular response to gluc ocorticoid stimulus	IBA	biological_process

KEGG pathways

hsa04080 Neuroactive ligand-receptor interaction
hsa04024 cAMP signaling pathway

Diseases

Associated diseases	References
Acromegaly	PMID: 15914528
Bipolar disorder	PMID: 12192619
Cancer	PMID: 16214911
Endometriosis	PMID: 20739383
Endometriosis	INFBASE20739383

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20739383	Endometrio sis			20 (15 patients affected by en dometriosis, 5 without endomet riosis)		sst5	Show abstract