Endometriosis Knowledgebase

Search Result

Gene id

6774

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

STAT3 Gene UCSC Ensembl

Aliases

ADMIO, ADMIO1, APRF, HIES

Gene name

signal transducer and activator of transcription 3

Alternate names

signal transducer and activator of transcription 3, DNA-binding protein APRF, acute-phase response factor,

Gene location

17q21.2 (42388504: 42313323) Exons: 24 NC_000017.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2015]

OMIM

102582

Protein Summary

Protein general information

P40763

Name: Signal transducer and activator of transcription 3 (Acute phase response factor)

Length: 770 Mass: 88,068

Tissue specificity: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQES
NVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQD
VRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLL
SAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDV
AALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGL
KIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQL
TTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYP
DIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGG
QFESLTFDMELTSECATSPM

Structural information

Protein Domains	SH2. (580-670)
Motifs	Essential for(150-162)
Interpro:	IPR008967 IPR000980 IPR001217 IPR013800 IPR015988 IPR013801 IPR012345 IPR013799
Prosite:	PS50001
Pfam:	PF00017 PF01017 PF02864 PF02865
PDB:	5AX3
PDBsum:	5AX3
DIP:	33584
MINT:	146801
STRING:	ENSP00000264657;

Other Databases

GeneCards: STAT3; Malacards: STAT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IMP	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IDA	molecular_function
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001754	eye photoreceptor cell di fferentiation	ISS	biological_process
GO:0003677	DNA binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	ISS	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	ISS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006606	protein import into nucle us	IDA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006953	acute-phase response	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007259	JAK-STAT cascade	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010730	negative regulation of hy drogen peroxide biosynthe tic process	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016310	phosphorylation	ISS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	NAS	biological_process
GO:0019901	protein kinase binding	ISS	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0019953	sexual reproduction	ISS	biological_process
GO:0030522	intracellular receptor si gnaling pathway	IDA	biological_process
GO:0031490	chromatin DNA binding	IDA	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IEA	molecular_function
GO:0032355	response to estradiol	IDA	biological_process
GO:0032870	cellular response to horm one stimulus	IDA	biological_process
GO:0033210	leptin-mediated signaling pathway	IDA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	TAS	biological_process
GO:0035259	glucocorticoid receptor b inding	IEA	molecular_function
GO:0035278	miRNA mediated inhibition of translation	IDA	biological_process
GO:0040014	regulation of multicellul ar organism growth	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	TAS	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042755	eating behavior	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044320	cellular response to lept in stimulus	IDA	biological_process
GO:0044321	response to leptin	IDA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0045820	negative regulation of gl ycolytic process	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	IEA	biological_process
GO:0046983	protein dimerization acti vity	ISS	molecular_function
GO:0048708	astrocyte differentiation	ISS	biological_process
GO:0051726	regulation of cell cycle	IDA	biological_process
GO:0060019	radial glial cell differe ntiation	ISS	biological_process
GO:0060259	regulation of feeding beh avior	ISS	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	ISS	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IC	cellular_component
GO:0090575	RNA polymerase II transcr iption factor complex	IMP	cellular_component
GO:0097009	energy homeostasis	ISS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1902728	positive regulation of gr owth factor dependent ske letal muscle satellite ce ll proliferation	IEA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IDA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IDA	biological_process
GO:1904685	positive regulation of me talloendopeptidase activi ty	IGI	biological_process
GO:2000637	positive regulation of ge ne silencing by miRNA	IDA	biological_process
GO:2001171	positive regulation of AT P biosynthetic process	IEA	biological_process
GO:2001223	negative regulation of ne uron migration	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IMP	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IDA	molecular_function
GO:0001659	temperature homeostasis	IEA	biological_process
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001754	eye photoreceptor cell di fferentiation	IEA	biological_process
GO:0001754	eye photoreceptor cell di fferentiation	ISS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	ISS	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	ISS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	ISS	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006606	protein import into nucle us	IDA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006953	acute-phase response	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007259	JAK-STAT cascade	TAS	biological_process
GO:0007259	JAK-STAT cascade	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010730	negative regulation of hy drogen peroxide biosynthe tic process	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016310	phosphorylation	IEA	biological_process
GO:0016310	phosphorylation	ISS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	NAS	biological_process
GO:0019827	stem cell population main tenance	IEA	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019901	protein kinase binding	ISS	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0019953	sexual reproduction	IEA	biological_process
GO:0019953	sexual reproduction	ISS	biological_process
GO:0030522	intracellular receptor si gnaling pathway	IDA	biological_process
GO:0031490	chromatin DNA binding	IDA	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IEA	molecular_function
GO:0032355	response to estradiol	IEA	biological_process
GO:0032355	response to estradiol	IDA	biological_process
GO:0032870	cellular response to horm one stimulus	IDA	biological_process
GO:0033210	leptin-mediated signaling pathway	IEA	biological_process
GO:0033210	leptin-mediated signaling pathway	IDA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	TAS	biological_process
GO:0035259	glucocorticoid receptor b inding	IEA	molecular_function
GO:0035278	miRNA mediated inhibition of translation	IDA	biological_process
GO:0040014	regulation of multicellul ar organism growth	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	TAS	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042755	eating behavior	IEA	biological_process
GO:0042755	eating behavior	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044320	cellular response to lept in stimulus	IDA	biological_process
GO:0044321	response to leptin	IEA	biological_process
GO:0044321	response to leptin	IDA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IEA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0045820	negative regulation of gl ycolytic process	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046902	regulation of mitochondri al membrane permeability	IEA	biological_process
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0046983	protein dimerization acti vity	ISS	molecular_function
GO:0048708	astrocyte differentiation	IEA	biological_process
GO:0048708	astrocyte differentiation	ISS	biological_process
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0051726	regulation of cell cycle	IDA	biological_process
GO:0060019	radial glial cell differe ntiation	IEA	biological_process
GO:0060019	radial glial cell differe ntiation	ISS	biological_process
GO:0060259	regulation of feeding beh avior	IEA	biological_process
GO:0060259	regulation of feeding beh avior	ISS	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	IEA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	ISS	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	IDA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0071345	cellular response to cyto kine stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IC	cellular_component
GO:0090575	RNA polymerase II transcr iption factor complex	IMP	cellular_component
GO:0097009	energy homeostasis	IEA	biological_process
GO:0097009	energy homeostasis	ISS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1902728	positive regulation of gr owth factor dependent ske letal muscle satellite ce ll proliferation	IEA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IDA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IDA	biological_process
GO:1904685	positive regulation of me talloendopeptidase activi ty	IGI	biological_process
GO:2000637	positive regulation of ge ne silencing by miRNA	IDA	biological_process
GO:2001171	positive regulation of AT P biosynthetic process	IEA	biological_process
GO:2001223	negative regulation of ne uron migration	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IMP	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IDA	molecular_function
GO:0001659	temperature homeostasis	ISS	biological_process
GO:0001754	eye photoreceptor cell di fferentiation	ISS	biological_process
GO:0003677	DNA binding	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	ISS	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	ISS	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006606	protein import into nucle us	IDA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007259	JAK-STAT cascade	TAS	biological_process
GO:0007259	JAK-STAT cascade	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016310	phosphorylation	ISS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	NAS	biological_process
GO:0019901	protein kinase binding	ISS	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0019953	sexual reproduction	ISS	biological_process
GO:0030522	intracellular receptor si gnaling pathway	IDA	biological_process
GO:0031490	chromatin DNA binding	IDA	molecular_function
GO:0032355	response to estradiol	IDA	biological_process
GO:0032870	cellular response to horm one stimulus	IDA	biological_process
GO:0033210	leptin-mediated signaling pathway	IDA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	TAS	biological_process
GO:0035278	miRNA mediated inhibition of translation	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	TAS	biological_process
GO:0042593	glucose homeostasis	ISS	biological_process
GO:0042755	eating behavior	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044320	cellular response to lept in stimulus	IDA	biological_process
GO:0044321	response to leptin	IDA	biological_process
GO:0045747	positive regulation of No tch signaling pathway	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046983	protein dimerization acti vity	ISS	molecular_function
GO:0048708	astrocyte differentiation	ISS	biological_process
GO:0051726	regulation of cell cycle	IDA	biological_process
GO:0060019	radial glial cell differe ntiation	ISS	biological_process
GO:0060259	regulation of feeding beh avior	ISS	biological_process
GO:0060396	growth hormone receptor s ignaling pathway	IDA	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	ISS	biological_process
GO:0060397	JAK-STAT cascade involved in growth hormone signal ing pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IC	cellular_component
GO:0090575	RNA polymerase II transcr iption factor complex	IMP	cellular_component
GO:0097009	energy homeostasis	ISS	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IDA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IDA	biological_process
GO:1904685	positive regulation of me talloendopeptidase activi ty	IGI	biological_process
GO:2000637	positive regulation of ge ne silencing by miRNA	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
PTHR11801:SF2  Angiogenesis
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04068  FoxO signaling pathway
hsa05145  Toxoplasmosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04659  Th17 cell differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05162  Measles
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa05321  Inflammatory bowel disease
hsa05212  Pancreatic cancer
hsa04217  Necroptosis
hsa04917  Prolactin signaling pathway
hsa04931  Insulin resistance
PTHR11801:SF2  Angiogenesis
hsa04920  Adipocytokine signaling pathway
hsa05223  Non-small cell lung cancer
hsa05221  Acute myeloid leukemia
PTHR11801:SF2  Angiogenesis
PTHR11801:SF2  CCKR signaling map
PTHR11801:SF2  Angiogenesis
PTHR11801:SF2  CCKR signaling map

Diseases

Associated diseases	References
Asthma	PMID: 15935090
Cardiovascular disease	PMID: 16807407
Crohn's disease	PMID: 18587394
Endometriosis	PMID: 25750101
Insulin resistance	PMID: 18239666
Endometriosis	INFBASE25750101
Multiple sclerosis	PMID: 20159113
Obesity	PMID: 17636079
Oral cancer	KEGG: H00016
Polycystic ovary syndrome (PCOS)	PMID: 17895321
Teratozoospermia	PMID: 26209830
Unexplained female infertility	PMID: 18047677

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25750101	Endometrio sis			43 (23 patients with endometri osis (6 for sta ge1, 9 for stag e 2, 5 for stag e 3, 3 fro stag e 4)), 20 contr ols (5 from pro liferative phas e, 7 from early secretory phas e, 4 from mid s ecretory and 4 from late secre tory)		STAT3 HIF1A	Show abstract