Search Result
| Gene id | 6776 | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary KEGG pathways Diseases PubMed references | |||||||||||||||||
Gene Summary |
|||||||||||||||||
| Gene Symbol | STAT5A Gene UCSC Ensembl | ||||||||||||||||
| Aliases | MGF, STAT5 | ||||||||||||||||
| Gene name | signal transducer and activator of transcription 5A | ||||||||||||||||
| Alternate names | signal transducer and activator of transcription 5A, epididymis secretory sperm binding protein, | ||||||||||||||||
| Gene location |
17q21.2 (42287546: 42311942) Exons: 20 NC_000017.11 |
||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013] |
||||||||||||||||
| OMIM | 601511 | ||||||||||||||||
Protein Summary |
|||||||||||||||||
| Protein general information | P42229 Name: Signal transducer and activator of transcription 5A Length: 794 Mass: 90,647 | ||||||||||||||||
| Sequence |
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQ VGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQKHLQINQTFEE LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQY RVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIIS EQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSV GSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGL TKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPK DEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDG EFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS | ||||||||||||||||
| Structural information |
| ||||||||||||||||
| Other Databases | GeneCards: STAT5A; Malacards: STAT5A | ||||||||||||||||
Gene ontology |
|||||||||||||||||
| |||||||||||||||||
KEGG pathways
|
|||||||||||||||||
|
hsa05221 Acute myeloid leukemia hsa05220 Chronic myeloid leukemia hsa05223 Non hsa05203 Viral carcinogenesis hsa04012 ErbB signaling pathway hsa04630 JAK-STAT signaling pathway hsa05162 Measles hsa04217 Necroptosis hsa04933 AGE-RAGE signaling pathway in diabetic complications hsa05161 Hepatitis B hsa05200 Pathways in cancer hsa04659 Th17 cell differentiation hsa05166 Human T-cell leukemia virus 1 infection hsa04658 Th1 and Th2 cell differentiation hsa04917 Prolactin signaling pathway | |||||||||||||||||
Diseases
|
|||||||||||||||||
| |||||||||||||||||
PubMed references |
|||||||||||||||||
|
|||||||||||||||||