Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6781
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol STC1   Gene   UCSC   Ensembl
Aliases STC
Gene name stanniocalcin 1
Alternate names stanniocalcin-1,
Gene location 8p21.2 (23854806: 23841920)     Exons: 4     NC_000008.11
Gene summary(Entrez) This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. [provided by RefSeq, Jul 2008]
OMIM 601185

Protein Summary

Protein general information P52823  

Name: Stanniocalcin-1 (STC-1)

Length: 247  Mass: 27,621

Tissue specificity: Expressed in most tissues, with the highest levels in ovary, prostate, heart, kidney and thyroid. In the kidney, expression is confined to the nephron, specifically in the distal convoluted tubule and in the collecting tubule. Not dete

Sequence MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICK
SFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQ
LPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVL
LRNLRGEEDSPSHIKRTSHESA
Structural information
Interpro:  IPR004978

Pfam:  
PF03298
STRING:   ENSP00000290271;
Other Databases GeneCards:  STC1;  Malacards:  STC1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001503 ossification
IEA biological_process
GO:0001886 endothelial cell morphoge
nesis
IDA biological_process
GO:0003421 growth plate cartilage ax
is specification
IDA biological_process
GO:0005179 hormone activity
IEA molecular_function
GO:0005615 extracellular space
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0006874 cellular calcium ion home
ostasis
IDA biological_process
GO:0006874 cellular calcium ion home
ostasis
IDA biological_process
GO:0007566 embryo implantation
IEA biological_process
GO:0010596 negative regulation of en
dothelial cell migration
IDA biological_process
GO:0016324 apical plasma membrane
IEA cellular_component
GO:0030336 negative regulation of ce
ll migration
IDA biological_process
GO:0033280 response to vitamin D
IEA biological_process
GO:0035988 chondrocyte proliferation
IDA biological_process
GO:0044070 regulation of anion trans
port
IDA biological_process
GO:0046697 decidualization
IEA biological_process
GO:0051926 negative regulation of ca
lcium ion transport
IDA biological_process
GO:0060348 bone development
IDA biological_process
GO:0071320 cellular response to cAMP
IEA biological_process
GO:0071385 cellular response to gluc
ocorticoid stimulus
IEA biological_process
GO:0071456 cellular response to hypo
xia
IEA biological_process
GO:0086004 regulation of cardiac mus
cle cell contraction
IDA biological_process
GO:0090280 positive regulation of ca
lcium ion import
IDA biological_process
GO:1903403 negative regulation of re
nal phosphate excretion
IDA biological_process
GO:0001503 ossification
IEA biological_process
GO:0001886 endothelial cell morphoge
nesis
IDA biological_process
GO:0003421 growth plate cartilage ax
is specification
IDA biological_process
GO:0005179 hormone activity
IEA molecular_function
GO:0005179 hormone activity
IEA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0006874 cellular calcium ion home
ostasis
IDA biological_process
GO:0006874 cellular calcium ion home
ostasis
IDA biological_process
GO:0007566 embryo implantation
IEA biological_process
GO:0010596 negative regulation of en
dothelial cell migration
IDA biological_process
GO:0014070 response to organic cycli
c compound
IEA biological_process
GO:0016324 apical plasma membrane
IEA cellular_component
GO:0030336 negative regulation of ce
ll migration
IDA biological_process
GO:0033280 response to vitamin D
IEA biological_process
GO:0035988 chondrocyte proliferation
IDA biological_process
GO:0044070 regulation of anion trans
port
IDA biological_process
GO:0046697 decidualization
IEA biological_process
GO:0051926 negative regulation of ca
lcium ion transport
IDA biological_process
GO:0060348 bone development
IDA biological_process
GO:0071320 cellular response to cAMP
IEA biological_process
GO:0071385 cellular response to gluc
ocorticoid stimulus
IEA biological_process
GO:0071456 cellular response to hypo
xia
IEA biological_process
GO:0086004 regulation of cardiac mus
cle cell contraction
IDA biological_process
GO:0090280 positive regulation of ca
lcium ion import
IDA biological_process
GO:1903403 negative regulation of re
nal phosphate excretion
IDA biological_process
GO:0001886 endothelial cell morphoge
nesis
IDA biological_process
GO:0003421 growth plate cartilage ax
is specification
IDA biological_process
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0006874 cellular calcium ion home
ostasis
IDA biological_process
GO:0006874 cellular calcium ion home
ostasis
IDA biological_process
GO:0010596 negative regulation of en
dothelial cell migration
IDA biological_process
GO:0030336 negative regulation of ce
ll migration
IDA biological_process
GO:0035988 chondrocyte proliferation
IDA biological_process
GO:0044070 regulation of anion trans
port
IDA biological_process
GO:0051926 negative regulation of ca
lcium ion transport
IDA biological_process
GO:0060348 bone development
IDA biological_process
GO:0086004 regulation of cardiac mus
cle cell contraction
IDA biological_process
GO:0090280 positive regulation of ca
lcium ion import
IDA biological_process
GO:1903403 negative regulation of re
nal phosphate excretion
IDA biological_process

Diseases

Associated diseases References
Kidney diseases GAD20383146
Amyotrophic lateral sclerosis GAD18608101
Diabetes GAD20628086
Endometriosis PubMed27322879

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
27322879 Endometrio
sis

52 (19 women wi
th endometriosi
s, 33 control w
omen)

Show abstract