Endometriosis Knowledgebase

Search Result

Gene id

6783

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SULT1E1 Gene UCSC Ensembl

Aliases

EST, EST-1, ST1E1, STE

Gene name

sulfotransferase family 1E member 1

Alternate names

estrogen sulfotransferase, estrone sulfotransferase, sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, sulfotransferase, estrogen-preferring,

Gene location

4q13.3 (304175: 438290) Exons: 12 NC_000005.10

Gene summary(Entrez)

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors. [provided by RefSeq, Jul 2008]

OMIM

600043

Protein Summary

Protein general information

P49888

Name: Estrogen sulfotransferase (EC 2.8.2.4) (EST-1) (Sulfotransferase 1E1) (ST1E1) (Sulfotransferase, estrogen-preferring)

Length: 294 Mass: 35,126

Tissue specificity: Liver, intestine and at lower level in the kidney.

Sequence

MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIF
NRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPN
PGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHH
TSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Structural information

Interpro:	IPR027417 IPR000863
Pfam:	PF00685
PDB:	1G3M 1HY3 4JVL 4JVM 4JVN
PDBsum:	1G3M 1HY3 4JVL 4JVM 4JVN
STRING:	ENSP00000226444;

Other Databases

GeneCards: SULT1E1; Malacards: SULT1E1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004062	aryl sulfotransferase act ivity	TAS	molecular_function
GO:0004062	aryl sulfotransferase act ivity	TAS	molecular_function
GO:0004304	estrone sulfotransferase activity	TAS	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0008146	sulfotransferase activity	IDA	molecular_function
GO:0008202	steroid metabolic process	TAS	biological_process
GO:0008210	estrogen metabolic proces s	IDA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IMP	biological_process
GO:0047894	flavonol 3-sulfotransfera se activity	IDA	molecular_function
GO:0050294	steroid sulfotransferase activity	IDA	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050427	3'-phosphoadenosine 5'-ph osphosulfate metabolic pr ocess	TAS	biological_process
GO:0051923	sulfation	IDA	biological_process
GO:0051923	sulfation	IDA	biological_process
GO:0004062	aryl sulfotransferase act ivity	TAS	molecular_function
GO:0004062	aryl sulfotransferase act ivity	TAS	molecular_function
GO:0004304	estrone sulfotransferase activity	IEA	molecular_function
GO:0004304	estrone sulfotransferase activity	TAS	molecular_function
GO:0004304	estrone sulfotransferase activity	TAS	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0008146	sulfotransferase activity	IEA	molecular_function
GO:0008146	sulfotransferase activity	IDA	molecular_function
GO:0008202	steroid metabolic process	TAS	biological_process
GO:0008210	estrogen metabolic proces s	IDA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0016740	transferase activity	IEA	molecular_function
GO:0045600	positive regulation of fa t cell differentiation	IMP	biological_process
GO:0047894	flavonol 3-sulfotransfera se activity	IDA	molecular_function
GO:0050294	steroid sulfotransferase activity	IDA	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050427	3'-phosphoadenosine 5'-ph osphosulfate metabolic pr ocess	TAS	biological_process
GO:0051923	sulfation	IDA	biological_process
GO:0051923	sulfation	IDA	biological_process
GO:0004062	aryl sulfotransferase act ivity	TAS	molecular_function
GO:0004062	aryl sulfotransferase act ivity	TAS	molecular_function
GO:0004304	estrone sulfotransferase activity	TAS	molecular_function
GO:0004304	estrone sulfotransferase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0008146	sulfotransferase activity	IDA	molecular_function
GO:0008202	steroid metabolic process	TAS	biological_process
GO:0008210	estrogen metabolic proces s	IDA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IMP	biological_process
GO:0047894	flavonol 3-sulfotransfera se activity	IDA	molecular_function
GO:0050294	steroid sulfotransferase activity	IDA	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050294	steroid sulfotransferase activity	TAS	molecular_function
GO:0050427	3'-phosphoadenosine 5'-ph osphosulfate metabolic pr ocess	TAS	biological_process
GO:0051923	sulfation	IDA	biological_process
GO:0051923	sulfation	IDA	biological_process

KEGG pathways

hsa00140 Steroid hormone biosynthesis

Diseases

Associated diseases	References
Testicular germ cell tumor	GAD19776291
Hearing Loss	GAD19898482
Endometrial cancer	GAD16985250
Chronic renal failure	GAD21085059
Breast cancer	GAD20214802
Breast cancer	GAD19551860
Breast cancer	GAD17372239
Breast cancer	GAD15894657
Endometriosis	PubMed23277161

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23277161	Endometrio sis			60 (31 ovarian endometriosis, 29 normal endom etrial)		SULT1E1 SULT2B1 UGT2B7 NQO1 CYP1B1 CYP3A5 SULT1A1 NQO2 GSTP1 CYP1A1 CYP3A7 and COMT	Show abstract