Endometriosis Knowledgebase

Search Result

Gene id

6811

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

STX5 Gene UCSC Ensembl

Aliases

SED5, STX5A

Gene name

syntaxin 5

Alternate names

syntaxin-5, syntaxin 5A,

Gene location

11q12.3 (62832090: 62806859) Exons: 11 NC_000011.10

Gene summary(Entrez)

This gene encodes a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for v-SNAREs (vesicle-SNAP receptors), permitting specific synaptic vesicle docking and fusion. The encoded protein regulates endoplasmic reticulum to Golgi transport and plays a critical role in autophagy. Autoantibodies targeting the encoded protein may be a diagnostic marker for endometriosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]

OMIM

603189

Protein Summary

Protein general information

Q13190

Name: Syntaxin 5

Length: 355 Mass: 39,673

Sequence

MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDRTQEFLSACKSLQTRQ
NGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQI
AQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNH
LGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA

Structural information

Protein Domains	t-SNARE (263-325)
Interpro:	IPR010989 IPR021538 IPR006012 IPR000727
Prosite:	PS00914 PS50192
Pfam:	PF05739 PF11416
PDB:	3EFO
PDBsum:	3EFO
DIP:	56987
MINT:	1376120
STRING:	ENSP00000294179;

Other Databases

GeneCards: STX5; Malacards: STX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IBA	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000149	SNARE binding	IBA	molecular_function
GO:0005484	SNAP receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006886	intracellular protein tra nsport	IBA	biological_process
GO:0006888	ER to Golgi vesicle-media ted transport	IBA	biological_process
GO:0006888	ER to Golgi vesicle-media ted transport	TAS	biological_process
GO:0006906	vesicle fusion	IBA	biological_process
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0031201	SNARE complex	TAS	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0034498	early endosome to Golgi t ransport	IMP	biological_process
GO:0042147	retrograde transport, end osome to Golgi	IDA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IMP	biological_process
GO:0047485	protein N-terminus bindin g	IPI	molecular_function
GO:0048208	COPII vesicle coating	TAS	biological_process
GO:0048278	vesicle docking	IBA	biological_process
GO:0048280	vesicle fusion with Golgi apparatus	IEA	biological_process
GO:0090166	Golgi disassembly	IDA	biological_process
GO:1903358	regulation of Golgi organ ization	IDA	biological_process
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0000139	Golgi membrane	IBA	cellular_component
GO:0000139	Golgi membrane	IEA	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000149	SNARE binding	IBA	molecular_function
GO:0005484	SNAP receptor activity	IEA	molecular_function
GO:0005484	SNAP receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006810	transport	IEA	biological_process
GO:0006886	intracellular protein tra nsport	IEA	biological_process
GO:0006886	intracellular protein tra nsport	IBA	biological_process
GO:0006888	ER to Golgi vesicle-media ted transport	IEA	biological_process
GO:0006888	ER to Golgi vesicle-media ted transport	IBA	biological_process
GO:0006888	ER to Golgi vesicle-media ted transport	TAS	biological_process
GO:0006906	vesicle fusion	IBA	biological_process
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016192	vesicle-mediated transpor t	IEA	biological_process
GO:0031201	SNARE complex	IEA	cellular_component
GO:0031201	SNARE complex	TAS	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	IEA	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0034498	early endosome to Golgi t ransport	IMP	biological_process
GO:0042147	retrograde transport, end osome to Golgi	IDA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IMP	biological_process
GO:0047485	protein N-terminus bindin g	IPI	molecular_function
GO:0048208	COPII vesicle coating	TAS	biological_process
GO:0048278	vesicle docking	IBA	biological_process
GO:0048280	vesicle fusion with Golgi apparatus	IEA	biological_process
GO:0090166	Golgi disassembly	IDA	biological_process
GO:1903358	regulation of Golgi organ ization	IDA	biological_process
GO:0000139	Golgi membrane	IBA	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000149	SNARE binding	IBA	molecular_function
GO:0005484	SNAP receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006886	intracellular protein tra nsport	IBA	biological_process
GO:0006888	ER to Golgi vesicle-media ted transport	IBA	biological_process
GO:0006888	ER to Golgi vesicle-media ted transport	TAS	biological_process
GO:0006906	vesicle fusion	IBA	biological_process
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0031201	SNARE complex	TAS	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular_component
GO:0034498	early endosome to Golgi t ransport	IMP	biological_process
GO:0042147	retrograde transport, end osome to Golgi	IDA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IMP	biological_process
GO:0047485	protein N-terminus bindin g	IPI	molecular_function
GO:0048208	COPII vesicle coating	TAS	biological_process
GO:0048278	vesicle docking	IBA	biological_process
GO:0090166	Golgi disassembly	IDA	biological_process
GO:1903358	regulation of Golgi organ ization	IDA	biological_process

KEGG pathways

hsa04130 SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Endometriosis	PMID: 24813083
Female infertility	INFBASE24813083
Dysmenorrhea	INFBASE24813083
Pelvic endometriosis	INFBASE24813083

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24813083	Endometrio sis			80 (60 women wi th confirmed pe lvic endometrio sis constituted the endometrio sis group, 20 w omen without en dometriosis)	Female infertility	CA125 syntaxin-5 and laminin-1	Show abstract