Endometriosis Knowledgebase

Search Result

Gene id

682

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

BSG Gene UCSC Ensembl

Aliases

5F7, CD147, EMMPRIN, OK, TCSF

Gene name

basigin (Ok blood group)

Alternate names

basigin, OK blood group antigen, collagenase stimulatory factor, extracellular matrix metalloproteinase inducer, leukocyte activation antigen M6, tumor cell-derived collagenase stimulatory factor,

Gene location

19p13.3 (571276: 583492) Exons: 10 NC_000019.10

Gene summary(Entrez)

The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

109480

Protein Summary

Protein general information

P35613

Name: Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell derived collagenase stimulatory factor) (TCSF) (CD antigen CD147)

Length: 385 Mass: 42,200

Tissue specificity: Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.

Sequence

MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGAR
LDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG
SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKA
VKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDK
GKNVRQRNSS

Structural information

Protein Domains	Ig-like (138-219) Ig-like (221-315)
Interpro:	IPR009151 IPR007110 IPR013783 IPR003599 IPR003598
Prosite:	PS50835
PDB:	3B5H 3I84 3I85 3QQN 3QR2 4U0Q
PDBsum:	3B5H 3I84 3I85 3QQN 3QR2 4U0Q
DIP:	50310
MINT:	5004205
STRING:	ENSP00000333769;

Other Databases

GeneCards: BSG; Malacards: BSG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002080	acrosomal membrane	IEA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005537	mannose binding	IEA	molecular_function
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	ISS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006090	pyruvate metabolic proces s	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0008028	monocarboxylic acid trans membrane transporter acti vity	TAS	molecular_function
GO:0015718	monocarboxylic acid trans port	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0042383	sarcolemma	IEA	cellular_component
GO:0042470	melanosome	IEA	cellular_component
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0046689	response to mercury ion	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0072661	protein targeting to plas ma membrane	ISS	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002080	acrosomal membrane	IEA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005537	mannose binding	IEA	molecular_function
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	ISS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006090	pyruvate metabolic proces s	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007566	embryo implantation	IEA	biological_process
GO:0008028	monocarboxylic acid trans membrane transporter acti vity	TAS	molecular_function
GO:0015718	monocarboxylic acid trans port	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0042383	sarcolemma	IEA	cellular_component
GO:0042470	melanosome	IEA	cellular_component
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0046689	response to mercury ion	IEA	biological_process
GO:0046697	decidualization	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0072661	protein targeting to plas ma membrane	IEA	biological_process
GO:0072661	protein targeting to plas ma membrane	ISS	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	ISS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006090	pyruvate metabolic proces s	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0008028	monocarboxylic acid trans membrane transporter acti vity	TAS	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0072661	protein targeting to plas ma membrane	ISS	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 25996258
Repeated implantation failure (RIF)	PMID: 24488920
Endometriosis	INFBASE29630856

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
25996258	Endometrio sis	42 (30 women wi th ovarian endo metriosis, 12 w omen without EM S)	CD147 Bcl-2 ERK	Show abstract
24661733	Endometrio sis	76 (60 women wi th chocolate cy sts, 16 control women without endometriosis)		Show abstract
29630856	Endometrio sis		CAS CD147 nuclearB-cat	Show abstract