Endometriosis Knowledgebase

Search Result

Gene id

6865

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TACR2 Gene UCSC Ensembl

Aliases

NK2R, NKNAR, SKR, TAC2R

Gene name

tachykinin receptor 2

Alternate names

substance-K receptor, NK-2 receptor, NK-2R, neurokinin 2 receptor, neurokinin A receptor, seven transmembrane helix receptor,

Gene location

10q22.1 (69416917: 69404201) Exons: 5 NC_000010.11

Gene summary(Entrez)

This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neuropeptide substance K, also referred to as neurokinin A. [provided by RefSeq, Jul 2008]

OMIM

162321

Protein Summary

Protein general information

P21452

Name: Substance K receptor (SKR) (NK 2 receptor) (NK 2R) (Neurokinin A receptor) (Tachykinin receptor 2)

Length: 398 Mass: 44,442

Sequence

MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNL
ALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKA
VIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLW
RRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGR
PQDGSGLWFGYGLLAPTKTHVEI

Structural information

Interpro:	IPR000276 IPR017452 IPR001681 IPR000913
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000362403;

Other Databases

GeneCards: TACR2; Malacards: TACR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004995	tachykinin receptor activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006936	muscle contraction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IBA	biological_process
GO:0007217	tachykinin receptor signa ling pathway	IEA	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0007588	excretion	TAS	biological_process
GO:0014057	positive regulation of ac etylcholine secretion, ne urotransmission	IEA	biological_process
GO:0014827	intestine smooth muscle c ontraction	IEA	biological_process
GO:0016497	substance K receptor acti vity	IBA	molecular_function
GO:0033685	negative regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035106	operant conditioning	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IEA	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	IBA	biological_process
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0070459	prolactin secretion	IEA	biological_process
GO:0070474	positive regulation of ut erine smooth muscle contr action	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004995	tachykinin receptor activ ity	IEA	molecular_function
GO:0004995	tachykinin receptor activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006936	muscle contraction	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IBA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007217	tachykinin receptor signa ling pathway	IEA	biological_process
GO:0007217	tachykinin receptor signa ling pathway	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0007588	excretion	TAS	biological_process
GO:0014057	positive regulation of ac etylcholine secretion, ne urotransmission	IEA	biological_process
GO:0014827	intestine smooth muscle c ontraction	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016497	substance K receptor acti vity	IEA	molecular_function
GO:0016497	substance K receptor acti vity	IBA	molecular_function
GO:0033685	negative regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035106	operant conditioning	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IEA	biological_process
GO:0043270	positive regulation of io n transport	IEA	biological_process
GO:0045987	positive regulation of sm ooth muscle contraction	IBA	biological_process
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0070459	prolactin secretion	IEA	biological_process
GO:0070472	regulation of uterine smo oth muscle contraction	IEA	biological_process
GO:0070474	positive regulation of ut erine smooth muscle contr action	IEA	biological_process
GO:0004995	tachykinin receptor activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006936	muscle contraction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IBA	biological_process
GO:0007217	tachykinin receptor signa ling pathway	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	IBA	biological_process
GO:0007588	excretion	TAS	biological_process
GO:0016497	substance K receptor acti vity	IBA	molecular_function
GO:0045987	positive regulation of sm ooth muscle contraction	IBA	biological_process

KEGG pathways

hsa04080 Neuroactive ligand-receptor interaction
hsa04020 Calcium signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 23553861
Endometriosis	INFBASE23553861

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23553861	Endometrio sis	FCRL3 -169T>C				TACR1 TACR2	Show abstract