Endometriosis Knowledgebase

Search Result

Gene id

6868

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ADAM17 Gene UCSC Ensembl

Aliases

ADAM18, CD156B, CSVP, NISBD, NISBD1, TACE

Gene name

ADAM metallopeptidase domain 17

Alternate names

disintegrin and metalloproteinase domain-containing protein 17, ADAM metallopeptidase domain 18, TNF-alpha convertase, TNF-alpha converting enzyme, snake venom-like protease, tumor necrosis factor, alpha, converting enzyme,

Gene location

2p25.1 (9555819: 9488485) Exons: 21 NC_000002.12

Gene summary(Entrez)

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. The encoded protease functions in the ectodomain shedding of tumor necrosis factor-alpha, in which soluble tumor necrosis factor-alpha is released from the membrane-bound precursor. This protease also functions in the processing of numerous other substrates, including cell adhesion proteins, cytokine and growth factor receptors and epidermal growth factor (EGF) receptor ligands. The encoded protein also plays a prominent role in the activation of the Notch signaling pathway. Elevated expression of this gene has been observed in specific cell types derived from psoriasis, rheumatoid arthritis, multiple sclerosis and Crohn's disease patients, suggesting that the encoded protein may play a role in autoimmune disease. [provided by RefSeq, Feb 2016]

OMIM

603639

Protein Summary

Protein general information

P78536

Name: Disintegrin and metalloproteinase domain containing protein 17 (ADAM 17) (EC 3.4.24.86) (Snake venom like protease) (TNF alpha convertase) (TNF alpha converting enzyme) (CD antigen CD156b)

Length: 824 Mass: 93,021

Tissue specificity: Ubiquitously expressed. Expressed at highest levels in adult heart, placenta, skeletal muscle, pancreas, spleen, thymus, prostate, testes, ovary and small intestine, and in fetal brain, lung, liver and kidney.

Sequence

MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSAL
KRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIE
PLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTC
KLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMF
SNCSKQSIYKTIESKAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNC
QFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTFGKFLADNIVGS
VLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPA
APKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC

Structural information

Protein Domains	Peptidase (223-474) Disintegrin. (475-563)
Motifs	Cysteine switch.(182-189) SH3-binding. {ECO:0000255}(731-738) SH3-binding. {ECO:0000255}.(741-748)
Interpro:	IPR034025 IPR032029 IPR001762 IPR024079 IPR001590 IPR002870
Prosite:	PS50215 PS50214 PS00142
Pfam:	PF16698 PF00200 PF01562
CDD:	cd04270
PDB:	1BKC 1ZXC 2A8H 2DDF 2FV5 2FV9 2I47 2M2F 2OI0 3B92 3CKI 3E8R 3EDZ 3EWJ 3G42 3KMC 3KME 3L0T 3L0V 3LE9 3LEA 3LGP 3O64
PDBsum:	1BKC 1ZXC 2A8H 2DDF 2FV5 2FV9 2I47 2M2F 2OI0 3B92 3CKI 3E8R 3EDZ 3EWJ 3G42 3KMC 3KME 3L0T 3L0V 3LE9 3LEA 3LGP 3O64
DIP:	31044
MINT:	108290
STRING:	ENSP00000309968;

Other Databases

GeneCards: ADAM17; Malacards: ADAM17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002446	neutrophil mediated immun ity	IC	biological_process
GO:0002467	germinal center formation	ISS	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IC	biological_process
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IMP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IMP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0005112	Notch binding	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IDA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007220	Notch receptor processing	IDA	biological_process
GO:0008237	metallopeptidase activity	IMP	molecular_function
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008237	metallopeptidase activity	TAS	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010820	positive regulation of T cell chemotaxis	IMP	biological_process
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0017124	SH3 domain binding	IEA	molecular_function
GO:0030165	PDZ domain binding	IPI	molecular_function
GO:0030183	B cell differentiation	ISS	biological_process
GO:0030307	positive regulation of ce ll growth	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030511	positive regulation of tr ansforming growth factor beta receptor signaling p athway	ISS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IMP	biological_process
GO:0031293	membrane protein intracel lular domain proteolysis	TAS	biological_process
GO:0031659	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity involved in G1/S tr ansition of mitotic cell cycle	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IMP	biological_process
GO:0033025	regulation of mast cell a poptotic process	ISS	biological_process
GO:0033077	T cell differentiation in thymus	ISS	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0033627	cell adhesion mediated by integrin	IDA	biological_process
GO:0035313	wound healing, spreading of epidermal cells	IEP	biological_process
GO:0035625	epidermal growth factor-a ctivated receptor transac tivation by G-protein cou pled receptor signaling p athway	IMP	biological_process
GO:0042493	response to drug	ISS	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IMP	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0048536	spleen development	ISS	biological_process
GO:0048870	cell motility	ISS	biological_process
GO:0050830	defense response to Gram- positive bacterium	IMP	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IMP	biological_process
GO:0051272	positive regulation of ce llular component movement	ISS	biological_process
GO:0055099	response to high density lipoprotein particle	IDA	biological_process
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002446	neutrophil mediated immun ity	IC	biological_process
GO:0002467	germinal center formation	ISS	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IC	biological_process
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IMP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IMP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0005112	Notch binding	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IDA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007220	Notch receptor processing	IDA	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IMP	molecular_function
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008237	metallopeptidase activity	TAS	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010820	positive regulation of T cell chemotaxis	IMP	biological_process
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0017124	SH3 domain binding	IEA	molecular_function
GO:0030165	PDZ domain binding	IPI	molecular_function
GO:0030183	B cell differentiation	ISS	biological_process
GO:0030307	positive regulation of ce ll growth	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030511	positive regulation of tr ansforming growth factor beta receptor signaling p athway	ISS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IMP	biological_process
GO:0031293	membrane protein intracel lular domain proteolysis	TAS	biological_process
GO:0031659	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity involved in G1/S tr ansition of mitotic cell cycle	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IMP	biological_process
GO:0033025	regulation of mast cell a poptotic process	ISS	biological_process
GO:0033077	T cell differentiation in thymus	ISS	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0033627	cell adhesion mediated by integrin	IDA	biological_process
GO:0035313	wound healing, spreading of epidermal cells	IEP	biological_process
GO:0035625	epidermal growth factor-a ctivated receptor transac tivation by G-protein cou pled receptor signaling p athway	IMP	biological_process
GO:0042493	response to drug	ISS	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IMP	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048536	spleen development	ISS	biological_process
GO:0048870	cell motility	ISS	biological_process
GO:0050830	defense response to Gram- positive bacterium	IMP	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IMP	biological_process
GO:0051272	positive regulation of ce llular component movement	ISS	biological_process
GO:0055099	response to high density lipoprotein particle	IDA	biological_process
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002446	neutrophil mediated immun ity	IC	biological_process
GO:0002467	germinal center formation	ISS	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IC	biological_process
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IMP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IMP	molecular_function
GO:0004222	metalloendopeptidase acti vity	IDA	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0005112	Notch binding	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006508	proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IMP	biological_process
GO:0006509	membrane protein ectodoma in proteolysis	IDA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IDA	biological_process
GO:0007220	Notch receptor processing	IDA	biological_process
GO:0008237	metallopeptidase activity	IMP	molecular_function
GO:0008237	metallopeptidase activity	IDA	molecular_function
GO:0008237	metallopeptidase activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010820	positive regulation of T cell chemotaxis	IMP	biological_process
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0030165	PDZ domain binding	IPI	molecular_function
GO:0030183	B cell differentiation	ISS	biological_process
GO:0030307	positive regulation of ce ll growth	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030511	positive regulation of tr ansforming growth factor beta receptor signaling p athway	ISS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IMP	biological_process
GO:0031293	membrane protein intracel lular domain proteolysis	TAS	biological_process
GO:0031659	positive regulation of cy clin-dependent protein se rine/threonine kinase act ivity involved in G1/S tr ansition of mitotic cell cycle	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IMP	biological_process
GO:0033025	regulation of mast cell a poptotic process	ISS	biological_process
GO:0033077	T cell differentiation in thymus	ISS	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	TAS	biological_process
GO:0033627	cell adhesion mediated by integrin	IDA	biological_process
GO:0035313	wound healing, spreading of epidermal cells	IEP	biological_process
GO:0035625	epidermal growth factor-a ctivated receptor transac tivation by G-protein cou pled receptor signaling p athway	IMP	biological_process
GO:0042493	response to drug	ISS	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IMP	biological_process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological_process
GO:0048536	spleen development	ISS	biological_process
GO:0048870	cell motility	ISS	biological_process
GO:0050830	defense response to Gram- positive bacterium	IMP	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IDA	biological_process
GO:0051088	PMA-inducible membrane pr otein ectodomain proteoly sis	IMP	biological_process
GO:0051272	positive regulation of ce llular component movement	ISS	biological_process
GO:0055099	response to high density lipoprotein particle	IDA	biological_process
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0032587	ruffle membrane	IDA	cellular_component

KEGG pathways

hsa05010  Alzheimer's disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04330  Notch signaling pathway

Diseases

Associated diseases	References
Cancer	PMID: 19124506
Cleft lip	PMID: 18978678
Coronary artery disease	PMID: 18600307
Crohn's disease	PMID: 18493210
Diabetes	PMID: 18442814
Endometriosis	PMID: 10849774
Female infertility	PMID: 10849774
Inflammatory bowel disease	OMIM: 603639
Obesity	PMID: 19819120
Endometriosis	INFBASE10849774

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
10849774	Endometrio sis					MMP-1 -2 -3 and -9 TIMP-1 and -2 TACE TNF-alpha	Show abstract