Endometriosis Knowledgebase

Search Result

Gene id

6876

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TAGLN Gene UCSC Ensembl

Aliases

SM22, SMCC, TAGLN1, WS3-10

Gene name

transgelin

Alternate names

transgelin, 22 kDa actin-binding protein, SM22-alpha, smooth muscle protein 22-alpha, transgelin variant 2,

Gene location

11q23.3 (117199323: 117204791) Exons: 5 NC_000011.10

Gene summary(Entrez)

The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

600818

Protein Summary

Protein general information

Q01995

Name: Transgelin (22 kDa actin binding protein) (Protein WS3 10) (Smooth muscle protein 22 alpha) (SM22 alpha)

Length: 201 Mass: 22,611

Sequence

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSK
PVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPN
WFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Structural information

Protein Domains	CH. (24-137)
Interpro:	IPR000557 IPR001715 IPR003096 IPR029976
Prosite:	PS01052 PS51122 PS50021
Pfam:	PF00402 PF00307
CDD:	cd00014
MINT:	2805284
STRING:	ENSP00000278968;

Other Databases

GeneCards: TAGLN; Malacards: TAGLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007517	muscle organ development	TAS	biological_process
GO:0030855	epithelial cell different iation	IDA	biological_process
GO:0003779	actin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007517	muscle organ development	TAS	biological_process
GO:0030855	epithelial cell different iation	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0007517	muscle organ development	TAS	biological_process
GO:0030855	epithelial cell different iation	IDA	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 21763649
Endometriosis	INFBASE21763649

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21763649	Endometrio sis					TAGLN	Show abstract