Endometriosis Knowledgebase

Search Result

Gene id

6885

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MAP3K7 Gene UCSC Ensembl

Aliases

CSCF, FMD2, MEKK7, TAK1, TGF1a

Gene name

mitogen-activated protein kinase kinase kinase 7

Alternate names

mitogen-activated protein kinase kinase kinase 7, TGF-beta activated kinase 1, transforming growth factor-beta-activated kinase 1,

Gene location

6q15 (90587300: 90513572) Exons: 17 NC_000006.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

OMIM

602614

Protein Summary

Protein general information

O43318

Name: Mitogen activated protein kinase kinase kinase 7 (EC 2.7.11.25) (Transforming growth factor beta activated kinase 1) (TGF beta activated kinase 1)

Length: 606 Mass: 67,196

Tissue specificity: Isoform 1A is the most abundant in ovary, skeletal muscle, spleen and blood mononuclear cells. Isoform 1B is highly expressed in brain, kidney and small intestine. Isoform 1C is the major form in prostate. Isoform 1D is the less abunda

Sequence

MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFI
VELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPK
ALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITR
RKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSS
VESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEP
GQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQ
HCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS

Structural information

Protein Domains	Protein (36-291)
Interpro:	IPR011009 IPR017421 IPR000719 IPR017441 IPR001245 IPR008271
Prosite:	PS00107 PS50011 PS00108
Pfam:	PF07714
PDB:	2EVA 2YIY 4GS6 4L3P 4L52 4L53 4O91 5E7R 5GJD 5GJF 5GJG 5J7S 5J8I 5J9L 5JGA 5JGB 5JGD 5JH6 5JK3
PDBsum:	2EVA 2YIY 4GS6 4L3P 4L52 4L53 4O91 5E7R 5GJD 5GJF 5GJG 5J7S 5J8I 5J9L 5JGA 5JGB 5JGD 5JH6 5JK3
DIP:	27523
MINT:	88554
STRING:	ENSP00000358335;

Other Databases

GeneCards: MAP3K7; Malacards: MAP3K7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000187	activation of MAPK activi ty	IDA	biological_process
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0000287	magnesium ion binding	IEA	molecular_function
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002726	positive regulation of T cell cytokine production	IMP	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004709	MAP kinase kinase kinase activity	EXP	molecular_function
GO:0004709	MAP kinase kinase kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005671	Ada2/Gcn5/Ada3 transcript ion activator complex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007223	Wnt signaling pathway, ca lcium modulating pathway	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	IMP	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	IMP	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0007254	JNK cascade	IDA	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0032743	positive regulation of in terleukin-2 production	IMP	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IDA	biological_process
GO:0043966	histone H3 acetylation	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	NAS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050870	positive regulation of T cell activation	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051403	stress-activated MAPK cas cade	IDA	biological_process
GO:0070423	nucleotide-binding oligom erization domain containi ng signaling pathway	TAS	biological_process
GO:0097110	scaffold protein binding	IDA	molecular_function
GO:0008385	IkappaB kinase complex	IPI	cellular_component
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000187	activation of MAPK activi ty	IDA	biological_process
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0000287	magnesium ion binding	IEA	molecular_function
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002726	positive regulation of T cell cytokine production	IMP	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular_function
GO:0004709	MAP kinase kinase kinase activity	IEA	molecular_function
GO:0004709	MAP kinase kinase kinase activity	EXP	molecular_function
GO:0004709	MAP kinase kinase kinase activity	IDA	molecular_function
GO:0004709	MAP kinase kinase kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005671	Ada2/Gcn5/Ada3 transcript ion activator complex	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007223	Wnt signaling pathway, ca lcium modulating pathway	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	IMP	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	IMP	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0007254	JNK cascade	IDA	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0032743	positive regulation of in terleukin-2 production	IMP	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IDA	biological_process
GO:0043966	histone H3 acetylation	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050852	T cell receptor signaling pathway	NAS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050870	positive regulation of T cell activation	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051403	stress-activated MAPK cas cade	IDA	biological_process
GO:0070423	nucleotide-binding oligom erization domain containi ng signaling pathway	TAS	biological_process
GO:0097110	scaffold protein binding	IDA	molecular_function
GO:0008385	IkappaB kinase complex	IPI	cellular_component
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000186	activation of MAPKK activ ity	IDA	biological_process
GO:0000187	activation of MAPK activi ty	IDA	biological_process
GO:0000187	activation of MAPK activi ty	TAS	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002726	positive regulation of T cell cytokine production	IMP	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004709	MAP kinase kinase kinase activity	EXP	molecular_function
GO:0004709	MAP kinase kinase kinase activity	IDA	molecular_function
GO:0004709	MAP kinase kinase kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005671	Ada2/Gcn5/Ada3 transcript ion activator complex	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007223	Wnt signaling pathway, ca lcium modulating pathway	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	IMP	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	IMP	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0007254	JNK cascade	IDA	biological_process
GO:0007254	JNK cascade	TAS	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0032743	positive regulation of in terleukin-2 production	IMP	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IDA	biological_process
GO:0043966	histone H3 acetylation	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	NAS	biological_process
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050870	positive regulation of T cell activation	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	TAS	biological_process
GO:0051403	stress-activated MAPK cas cade	IDA	biological_process
GO:0070423	nucleotide-binding oligom erization domain containi ng signaling pathway	TAS	biological_process
GO:0097110	scaffold protein binding	IDA	molecular_function
GO:0008385	IkappaB kinase complex	IPI	cellular_component

KEGG pathways

hsa04010  MAPK signaling pathway
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05145  Toxoplasmosis
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05162  Measles
hsa04657  IL-17 signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa05140  Leishmaniasis
hsa04152  AMPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04520  Adherens junction
hsa04140  Autophagy - animal
hsa04310  Wnt signaling pathway
hsa04622  RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 19410630
Endometriosis	INFBASE19410630
Polycystic ovary syndrome (PCOS)	PMID: 24423322

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19410630	Endometrio sis					ICAM-3 IL-6 IL-8 TAK1 JNK2 RelA and TLR4 TNFalpha	Show abstract