Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 6997
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol TDGF1   Gene   UCSC   Ensembl
Aliases CR, CRGF, CRIPTO
Gene name teratocarcinoma-derived growth factor 1
Alternate names teratocarcinoma-derived growth factor 1, cripto-1 growth factor, epidermal growth factor-like cripto protein CR1,
Gene location 3p21.31 (46574554: 46582462)     Exons: 7     NC_000003.12
Gene summary(Entrez) This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
OMIM 187395

Protein Summary

Protein general information P13385  

Name: Teratocarcinoma derived growth factor 1 (Cripto 1 growth factor) (CRGF) (Epidermal growth factor like cripto protein CR1)

Length: 188  Mass: 21,169

Tissue specificity: Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung. {ECO

Sequence MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHS
KELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
GLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY
Structural information
Protein Domains
EGF-like. (78-107)
Interpro:  IPR017047 IPR019011 IPR013032 IPR000742
Prosite:   PS00022 PS50026

Pfam:  
PF09443
MINT:   1386411
STRING:   ENSP00000296145;
Other Databases GeneCards:  TDGF1;  Malacards:  TDGF1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0001763 morphogenesis of a branch
ing structure
TAS biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IMP biological_process
GO:0005102 receptor binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0007507 heart development
IDA biological_process
GO:0008083 growth factor activity
IDA molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0008595 anterior/posterior axis s
pecification, embryo
ISS biological_process
GO:0009790 embryo development
TAS biological_process
GO:0009966 regulation of signal tran
sduction
IDA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0016324 apical plasma membrane
IDA cellular_component
GO:0018105 peptidyl-serine phosphory
lation
IDA biological_process
GO:0019897 extrinsic component of pl
asma membrane
ISS cellular_component
GO:0030154 cell differentiation
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030879 mammary gland development
TAS biological_process
GO:0031225 anchored component of mem
brane
IEA cellular_component
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological_process
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0044344 cellular response to fibr
oblast growth factor stim
ulus
IDA biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IDA biological_process
GO:0071354 cellular response to inte
rleukin-6
IDA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IDA biological_process
GO:0071364 cellular response to epid
ermal growth factor stimu
lus
IDA biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
IDA biological_process
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0001763 morphogenesis of a branch
ing structure
TAS biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IMP biological_process
GO:0005102 receptor binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0007507 heart development
IDA biological_process
GO:0008083 growth factor activity
IEA molecular_function
GO:0008083 growth factor activity
IEA molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0008595 anterior/posterior axis s
pecification, embryo
ISS biological_process
GO:0009790 embryo development
TAS biological_process
GO:0009966 regulation of signal tran
sduction
IDA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016324 apical plasma membrane
IDA cellular_component
GO:0018105 peptidyl-serine phosphory
lation
IDA biological_process
GO:0019897 extrinsic component of pl
asma membrane
ISS cellular_component
GO:0030154 cell differentiation
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030879 mammary gland development
TAS biological_process
GO:0031225 anchored component of mem
brane
IEA cellular_component
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological_process
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0044344 cellular response to fibr
oblast growth factor stim
ulus
IDA biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IDA biological_process
GO:0071354 cellular response to inte
rleukin-6
IDA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IDA biological_process
GO:0071364 cellular response to epid
ermal growth factor stimu
lus
IDA biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
IDA biological_process
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0000187 activation of MAPK activi
ty
IDA biological_process
GO:0001763 morphogenesis of a branch
ing structure
TAS biological_process
GO:0002042 cell migration involved i
n sprouting angiogenesis
IMP biological_process
GO:0005102 receptor binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0007507 heart development
IDA biological_process
GO:0008083 growth factor activity
IDA molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0008595 anterior/posterior axis s
pecification, embryo
ISS biological_process
GO:0009790 embryo development
TAS biological_process
GO:0009966 regulation of signal tran
sduction
IDA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0016324 apical plasma membrane
IDA cellular_component
GO:0018105 peptidyl-serine phosphory
lation
IDA biological_process
GO:0019897 extrinsic component of pl
asma membrane
ISS cellular_component
GO:0030154 cell differentiation
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030879 mammary gland development
TAS biological_process
GO:0035019 somatic stem cell populat
ion maintenance
TAS biological_process
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0044344 cellular response to fibr
oblast growth factor stim
ulus
IDA biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IDA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IDA biological_process
GO:0071354 cellular response to inte
rleukin-6
IDA biological_process
GO:0071356 cellular response to tumo
r necrosis factor
IDA biological_process
GO:0071364 cellular response to epid
ermal growth factor stimu
lus
IDA biological_process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
IDA biological_process

Diseases

Associated diseases References
Endometriosis PMID: 25228630
Forebrain defects OMIM: 187395
Endometriosis INFBASE25228630
Ovarian endometriosis INFBASE19386982
Ovarian endometriosis PMID: 19386982
Ovarian endometriosis PMID: 19386982

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25228630 Endometrio
sis

27 (15 women wi
th endometriosi
s, 15 women wit
hout endometrio
sis)
Nodal
Cripto
SMAD3
SMAD4
Show abstract
19386982 Endometrio
sis (ovari
an)

30 (15 women wi
th ovarian endo
metrioma, 15 eu
topic endometri
um of healthy p
articipants)
Activin A
ActRII
nodal
cripto
Show abstract