Endometriosis Knowledgebase

Search Result

Gene id

7010

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TEK Gene UCSC Ensembl

Aliases

CD202B, GLC3E, TIE-2, TIE2, VMCM, VMCM1

Gene name

TEK receptor tyrosine kinase

Alternate names

angiopoietin-1 receptor, TEK tyrosine kinase, endothelial, endothelial tyrosine kinase, tunica interna endothelial cell kinase, tyrosine kinase with Ig and EGF homology domains-2, tyrosine-protein kinase receptor TEK, tyrosine-protein kinase receptor TIE-2,

Gene location

9p21.2 (27109140: 27230177) Exons: 23 NC_000009.12

Gene summary(Entrez)

This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fibronectin type III repeats. The ligand angiopoietin-1 binds to this receptor and mediates a signaling pathway that functions in embryonic vascular development. Mutations in this gene are associated with inherited venous malformations of the skin and mucous membranes. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]

OMIM

600221

Protein Summary

Protein general information

Q02763

Name: Angiopoietin 1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains 2) (Tyrosine protein kinase receptor TEK) (Tyrosine protein kinase receptor TIE 2) (hTIE2) (p140

Length: 1124 Mass: 125,830

Tissue specificity: Detected in umbilical vein endothelial cells. Proteolytic processing gives rise to a soluble extracellular domain that is detected in blood plasma (at protein level). Predominantly expressed in endothelial cells and their progenitors,

Sequence

MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVT
QDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKE
EDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCT
ACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGW
PLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNA
PNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEG
GEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYK
VQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIA
ILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIK
FQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGEN
YVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK
LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA

Structural information

Protein Domains	Ig-like (44-123) EGF-like (210-252) EGF-like (254-299) EGF-like (301-341) Ig (350-440)
Interpro:	IPR013032 IPR000742 IPR003961 IPR007110 IPR013783 IPR011009 IPR000719 IPR017441 IPR001245 IPR018941 IPR008266 IPR020635
Prosite:	PS00022 PS01186 PS50026 PS50853 PS50835 PS00107 PS50011 PS00109
Pfam:	PF00041 PF10430 PF07714
CDD:	cd00063
PDB:	1FVR 2GY5 2GY7 2OO8 2OSC 2P4I 2WQB 3BEA 3L8P 4K0V 4X3J
PDBsum:	1FVR 2GY5 2GY7 2OO8 2OSC 2P4I 2WQB 3BEA 3L8P 4K0V 4X3J
DIP:	6047
STRING:	ENSP00000369375;

Other Databases

GeneCards: TEK; Malacards: TEK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001935	endothelial cell prolifer ation	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0001958	endochondral ossification	IEA	biological_process
GO:0002040	sprouting angiogenesis	IMP	biological_process
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IDA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007507	heart development	ISS	biological_process
GO:0009925	basal plasma membrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0016525	negative regulation of an giogenesis	IMP	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IEA	molecular_function
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032878	regulation of establishme nt or maintenance of cell polarity	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051259	protein oligomerization	IDA	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0060216	definitive hemopoiesis	TAS	biological_process
GO:0060347	heart trabecula formation	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:1902533	positive regulation of in tracellular signal transd uction	IMP	biological_process
GO:2000251	positive regulation of ac tin cytoskeleton reorgani zation	IMP	biological_process
GO:2000351	regulation of endothelial cell apoptotic process	TAS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	ISS	biological_process
GO:0001725	stress fiber	IDA	cellular_component
GO:0005884	actin filament	IDA	cellular_component
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001525	angiogenesis	ISS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001935	endothelial cell prolifer ation	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0001958	endochondral ossification	IEA	biological_process
GO:0002040	sprouting angiogenesis	IMP	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IDA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007507	heart development	ISS	biological_process
GO:0009925	basal plasma membrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0016525	negative regulation of an giogenesis	IMP	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IEA	molecular_function
GO:0030054	cell junction	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0032878	regulation of establishme nt or maintenance of cell polarity	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IMP	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051259	protein oligomerization	IDA	biological_process
GO:0051591	response to cAMP	IEA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0060216	definitive hemopoiesis	TAS	biological_process
GO:0060347	heart trabecula formation	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:1902533	positive regulation of in tracellular signal transd uction	IMP	biological_process
GO:2000251	positive regulation of ac tin cytoskeleton reorgani zation	IMP	biological_process
GO:2000351	regulation of endothelial cell apoptotic process	TAS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	ISS	biological_process
GO:0001725	stress fiber	IDA	cellular_component
GO:0005884	actin filament	IDA	cellular_component
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001525	angiogenesis	ISS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001935	endothelial cell prolifer ation	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0002040	sprouting angiogenesis	IMP	biological_process
GO:0004672	protein kinase activity	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0005911	cell-cell junction	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IDA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007507	heart development	ISS	biological_process
GO:0009925	basal plasma membrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IDA	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IMP	biological_process
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0016525	negative regulation of an giogenesis	IMP	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0032878	regulation of establishme nt or maintenance of cell polarity	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043114	regulation of vascular pe rmeability	TAS	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IMP	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045766	positive regulation of an giogenesis	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0048014	Tie signaling pathway	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051259	protein oligomerization	IDA	biological_process
GO:0051894	positive regulation of fo cal adhesion assembly	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0060216	definitive hemopoiesis	TAS	biological_process
GO:0060347	heart trabecula formation	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:1902533	positive regulation of in tracellular signal transd uction	IMP	biological_process
GO:2000251	positive regulation of ac tin cytoskeleton reorgani zation	IMP	biological_process
GO:2000351	regulation of endothelial cell apoptotic process	TAS	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	ISS	biological_process
GO:0001725	stress fiber	IDA	cellular_component
GO:0005884	actin filament	IDA	cellular_component

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05323  Rheumatoid arthritis

Diseases

Associated diseases	References
Endometriosis	PMID: 16723371
Glaucoma	OMIM: 600221
Endometriosis	INFBASE16723371
Venous malformations	KEGG: H00531, OMIM: 600221

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16723371	Endometrio sis			120 (56 women w ith severe endo metriosis, 64 w omen without en dometriosis)		Ang-1 Ang-2 Tie-2	Show abstract