Endometriosis Knowledgebase

Search Result

Gene id

7015

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TERT Gene UCSC Ensembl

Aliases

CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, hTRT

Gene name

telomerase reverse transcriptase

Alternate names

telomerase reverse transcriptase, telomerase catalytic subunit, telomerase-associated protein 2,

Gene location

5p15.33 (1295625: 1253166) Exons: 16 NC_000005.10

Gene summary(Entrez)

Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity. [provided by RefSeq, Jul 2008]

OMIM

187270

Protein Summary

Protein general information

O14746

Name: Telomerase reverse transcriptase (EC 2.7.7.49) (HEST2) (Telomerase catalytic subunit) (Telomerase associated protein 2) (TP2)

Length: 1132 Mass: 126,997

Tissue specificity: Expressed at a high level in thymocyte subpopulations, at an intermediate level in tonsil T-lymphocytes, and at a low to undetectable level in peripheral blood T-lymphocytes. {ECO

Sequence

MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVS
CLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLV
HLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRG
GSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGT
PRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQ
LLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPG
VGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGL
LGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKA
AHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSY
VQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLF
GVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAK
NAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPS
DFKTILD

Structural information

Protein Domains	Reverse (605-935)
Motifs	Bipartite nuclear(222-240) TFL (328-333) binding. {ECO:0000250\|UniProtKB:Q4KTA7}.(in-RNA)
Interpro:	IPR000477 IPR021891 IPR003545
Prosite:	PS50878
Pfam:	PF00078 PF12009
PDB:	2BCK 4B18 4MNQ 5MEN 5MEP 5MEQ 5MER 5UGW
PDBsum:	2BCK 4B18 4MNQ 5MEN 5MEP 5MEQ 5MER 5UGW
DIP:	40646
MINT:	133963
STRING:	ENSP00000309572;

Other Databases

GeneCards: TERT; Malacards: TERT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000049	tRNA binding	IDA	molecular_function
GO:0000333	telomerase catalytic core complex	IMP	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IPI	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000723	telomere maintenance	TAS	biological_process
GO:0000781	chromosome, telomeric reg ion	IC	cellular_component
GO:0000783	nuclear telomere cap comp lex	IC	cellular_component
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular_component
GO:0001172	transcription, RNA-templa ted	IDA	biological_process
GO:0001223	transcription coactivator binding	IPI	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	TAS	molecular_function
GO:0003720	telomerase activity	TAS	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	TAS	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003723	RNA binding	IPI	molecular_function
GO:0003964	RNA-directed DNA polymera se activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005697	telomerase holoenzyme com plex	IDA	cellular_component
GO:0005697	telomerase holoenzyme com plex	IDA	cellular_component
GO:0005697	telomerase holoenzyme com plex	IPI	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	NAS	cellular_component
GO:0006278	RNA-dependent DNA biosynt hetic process	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	NAS	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IMP	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007005	mitochondrion organizatio n	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016779	nucleotidyltransferase ac tivity	IDA	molecular_function
GO:0022616	DNA strand elongation	IDA	biological_process
GO:0030177	positive regulation of Wn t signaling pathway	IGI	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0031379	RNA-directed RNA polymera se complex	IPI	cellular_component
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0031647	regulation of protein sta bility	IMP	biological_process
GO:0032092	positive regulation of pr otein binding	IDA	biological_process
GO:0032774	RNA biosynthetic process	IDA	biological_process
GO:0042162	telomeric DNA binding	TAS	molecular_function
GO:0042635	positive regulation of ha ir cycle	IEA	biological_process
GO:0042645	mitochondrial nucleoid	IDA	cellular_component
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0070034	telomerase RNA binding	IDA	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070200	establishment of protein localization to telomere	IDA	biological_process
GO:0071456	cellular response to hypo xia	IMP	biological_process
GO:0071897	DNA biosynthetic process	IDA	biological_process
GO:0071897	DNA biosynthetic process	IDA	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1903704	negative regulation of pr oduction of siRNA involve d in RNA interference	IDA	biological_process
GO:1904751	positive regulation of pr otein localization to nuc leolus	IDA	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:1990572	TERT-RMRP complex	IDA	cellular_component
GO:2000648	positive regulation of st em cell proliferation	IEA	biological_process
GO:2000773	negative regulation of ce llular senescence	IMP	biological_process
GO:2000773	negative regulation of ce llular senescence	IDA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IMP	biological_process
GO:0016605	PML body	IDA	cellular_component
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IMP	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003968	RNA-directed 5'-3' RNA po lymerase activity	IDA	molecular_function
GO:0000049	tRNA binding	IDA	molecular_function
GO:0000333	telomerase catalytic core complex	IEA	cellular_component
GO:0000333	telomerase catalytic core complex	IMP	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IPI	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000723	telomere maintenance	TAS	biological_process
GO:0000781	chromosome, telomeric reg ion	IEA	cellular_component
GO:0000781	chromosome, telomeric reg ion	IEA	cellular_component
GO:0000781	chromosome, telomeric reg ion	IC	cellular_component
GO:0000783	nuclear telomere cap comp lex	IC	cellular_component
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular_component
GO:0001172	transcription, RNA-templa ted	IDA	biological_process
GO:0001223	transcription coactivator binding	IEA	molecular_function
GO:0001223	transcription coactivator binding	IPI	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003720	telomerase activity	IEA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	TAS	molecular_function
GO:0003720	telomerase activity	TAS	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IEA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	TAS	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003723	RNA binding	IPI	molecular_function
GO:0003964	RNA-directed DNA polymera se activity	IEA	molecular_function
GO:0003964	RNA-directed DNA polymera se activity	IEA	molecular_function
GO:0003964	RNA-directed DNA polymera se activity	IEA	molecular_function
GO:0003964	RNA-directed DNA polymera se activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005697	telomerase holoenzyme com plex	IDA	cellular_component
GO:0005697	telomerase holoenzyme com plex	IDA	cellular_component
GO:0005697	telomerase holoenzyme com plex	IPI	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	NAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0006278	RNA-dependent DNA biosynt hetic process	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	NAS	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IMP	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007005	mitochondrion organizatio n	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016605	PML body	IEA	cellular_component
GO:0016740	transferase activity	IEA	molecular_function
GO:0016779	nucleotidyltransferase ac tivity	IEA	molecular_function
GO:0016779	nucleotidyltransferase ac tivity	IDA	molecular_function
GO:0022616	DNA strand elongation	IDA	biological_process
GO:0030177	positive regulation of Wn t signaling pathway	IEA	biological_process
GO:0030177	positive regulation of Wn t signaling pathway	IGI	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0030529	intracellular ribonucleop rotein complex	IEA	cellular_component
GO:0031379	RNA-directed RNA polymera se complex	IPI	cellular_component
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0031647	regulation of protein sta bility	IMP	biological_process
GO:0032092	positive regulation of pr otein binding	IDA	biological_process
GO:0032774	RNA biosynthetic process	IDA	biological_process
GO:0042162	telomeric DNA binding	TAS	molecular_function
GO:0042635	positive regulation of ha ir cycle	IEA	biological_process
GO:0042645	mitochondrial nucleoid	IDA	cellular_component
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0070034	telomerase RNA binding	IEA	molecular_function
GO:0070034	telomerase RNA binding	IDA	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070200	establishment of protein localization to telomere	IDA	biological_process
GO:0071456	cellular response to hypo xia	IMP	biological_process
GO:0071897	DNA biosynthetic process	IDA	biological_process
GO:0071897	DNA biosynthetic process	IDA	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1903704	negative regulation of pr oduction of siRNA involve d in RNA interference	IDA	biological_process
GO:1904751	positive regulation of pr otein localization to nuc leolus	IDA	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:1990572	TERT-RMRP complex	IDA	cellular_component
GO:2000648	positive regulation of st em cell proliferation	IEA	biological_process
GO:2000773	negative regulation of ce llular senescence	IMP	biological_process
GO:2000773	negative regulation of ce llular senescence	IDA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IMP	biological_process
GO:0016605	PML body	IDA	cellular_component
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IMP	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003968	RNA-directed 5'-3' RNA po lymerase activity	IDA	molecular_function
GO:0000049	tRNA binding	IDA	molecular_function
GO:0000333	telomerase catalytic core complex	IMP	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IPI	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000333	telomerase catalytic core complex	IDA	cellular_component
GO:0000723	telomere maintenance	TAS	biological_process
GO:0000781	chromosome, telomeric reg ion	IC	cellular_component
GO:0000783	nuclear telomere cap comp lex	IC	cellular_component
GO:0000784	nuclear chromosome, telom eric region	IDA	cellular_component
GO:0001172	transcription, RNA-templa ted	IDA	biological_process
GO:0001223	transcription coactivator binding	IPI	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	TAS	molecular_function
GO:0003720	telomerase activity	TAS	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	TAS	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003723	RNA binding	IPI	molecular_function
GO:0003964	RNA-directed DNA polymera se activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005697	telomerase holoenzyme com plex	IDA	cellular_component
GO:0005697	telomerase holoenzyme com plex	IDA	cellular_component
GO:0005697	telomerase holoenzyme com plex	IPI	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	NAS	cellular_component
GO:0006278	RNA-dependent DNA biosynt hetic process	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	NAS	biological_process
GO:0007004	telomere maintenance via telomerase	IDA	biological_process
GO:0007004	telomere maintenance via telomerase	IMP	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007004	telomere maintenance via telomerase	TAS	biological_process
GO:0007005	mitochondrion organizatio n	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016779	nucleotidyltransferase ac tivity	IDA	molecular_function
GO:0022616	DNA strand elongation	IDA	biological_process
GO:0030177	positive regulation of Wn t signaling pathway	IGI	biological_process
GO:0030422	production of siRNA invol ved in RNA interference	IDA	biological_process
GO:0031379	RNA-directed RNA polymera se complex	IPI	cellular_component
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0031647	regulation of protein sta bility	IMP	biological_process
GO:0032092	positive regulation of pr otein binding	IDA	biological_process
GO:0032774	RNA biosynthetic process	IDA	biological_process
GO:0042162	telomeric DNA binding	TAS	molecular_function
GO:0042645	mitochondrial nucleoid	IDA	cellular_component
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IDA	biological_process
GO:0070034	telomerase RNA binding	IDA	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070034	telomerase RNA binding	IPI	molecular_function
GO:0070200	establishment of protein localization to telomere	IDA	biological_process
GO:0071456	cellular response to hypo xia	IMP	biological_process
GO:0071897	DNA biosynthetic process	IDA	biological_process
GO:0071897	DNA biosynthetic process	IDA	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1903704	negative regulation of pr oduction of siRNA involve d in RNA interference	IDA	biological_process
GO:1904751	positive regulation of pr otein localization to nuc leolus	IDA	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:1990572	TERT-RMRP complex	IDA	cellular_component
GO:2000773	negative regulation of ce llular senescence	IMP	biological_process
GO:2000773	negative regulation of ce llular senescence	IDA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IMP	biological_process
GO:0016605	PML body	IDA	cellular_component
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003720	telomerase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IMP	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003721	telomerase RNA reverse tr anscriptase activity	IDA	molecular_function
GO:0003968	RNA-directed 5'-3' RNA po lymerase activity	IDA	molecular_function

KEGG pathways

hsa05166 HTLV-I infection

Diseases

Associated diseases	References
Aplastic anemia	KEGG: H01132
Asthenozoospermia	PMID: 18727729
Azoospermia	PMID: 10731529
Bone marrow diseases	PMID: 17936651
Cancer	PMID: 21827660
Cri du chat	KEGG: H00764
Dyskeratosis congenita	KEGG: H00507
Endometriosis	PMID: 17077107
Idiopathic pulmonary fibrosis	KEGG: H01299
Male infertility	PMID: 24269974
Maturation arrest (MA)	PMID: 10731529
Medulloblastoma	KEGG: H01667
Endometriosis	INFBASE17077107
Myocardial infarction	PMID: 16890917
Oligozoospermia	PMID: 18727729
Premature ovarian failure ( POF)	PMID: 10778807
Recurrent reproductive failure	PMID: 18765014
Sertoli cell-only syndrome (SCOS)	PMID: 10731529
Spermatogenetic defects	PMID: 11756380
Teratozoospermia	PMID: 18727729

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17077107	Endometrio sis			60 (30 endometr iosis patients, 30 patients wi thout endometri osis)		hTERT	Show abstract