Endometriosis Knowledgebase

Search Result

Gene id

7026

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NR2F2 Gene UCSC Ensembl

Aliases

ARP1, CHTD4, COUPTFB, COUPTFII, NF-E3, NR2F1, SVP40, TFCOUP2

Gene name

nuclear receptor subfamily 2 group F member 2

Alternate names

COUP transcription factor 2, ADP-ribosylation factor related protein 1, COUP transcription factor II, apolipoprotein A-I regulatory protein 1, apolipoprotein AI regulatory protein 1, chicken ovalbumin upstream promoter transcription factor 2, chicken ovalbumin ,

Gene location

15q26.2 (96325927: 96340262) Exons: 6 NC_000015.10

Gene summary(Entrez)

This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

OMIM

107773

Protein Summary

Protein general information

P24468

Name: COUP transcription factor 2 (COUP TF2) (Apolipoprotein A I regulatory protein 1) (ARP 1) (COUP transcription factor II) (COUP TF II) (Nuclear receptor subfamily 2 group F member 2)

Length: 414 Mass: 45,571

Tissue specificity: Ubiquitous.

Sequence

MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQ
HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ
RGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVE
WARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSS
SVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

Structural information

Interpro:	IPR003068 IPR000536 IPR001723 IPR001628 IPR013088
Prosite:	PS00031 PS51030
Pfam:	PF00104 PF00105
PDB:	3CJW
PDBsum:	3CJW
DIP:	29713
MINT:	1183332
STRING:	ENSP00000377721;

Other Databases

GeneCards: MIR1469;NR2F2; Malacards: MIR1469

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0001764	neuron migration	IEA	biological_process
GO:0001893	maternal placenta develop ment	IEA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001972	retinoic acid binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0003714	transcription corepressor activity	TAS	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006629	lipid metabolic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007519	skeletal muscle tissue de velopment	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009566	fertilization	IEA	biological_process
GO:0009952	anterior/posterior patter n specification	IEA	biological_process
GO:0009956	radial pattern formation	IEA	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IMP	biological_process
GO:0030522	intracellular receptor si gnaling pathway	IEA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0048514	blood vessel morphogenesi s	IEA	biological_process
GO:0060173	limb development	IEA	biological_process
GO:0060674	placenta blood vessel dev elopment	IEA	biological_process
GO:0060707	trophoblast giant cell di fferentiation	IEA	biological_process
GO:0060849	regulation of transcripti on involved in lymphatic endothelial cell fate com mitment	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001764	neuron migration	IEA	biological_process
GO:0001893	maternal placenta develop ment	IEA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001945	lymph vessel development	IEA	biological_process
GO:0001972	retinoic acid binding	IDA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003707	steroid hormone receptor activity	IEA	molecular_function
GO:0003714	transcription corepressor activity	TAS	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IEA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006629	lipid metabolic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007519	skeletal muscle tissue de velopment	IEA	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009566	fertilization	IEA	biological_process
GO:0009952	anterior/posterior patter n specification	IEA	biological_process
GO:0009956	radial pattern formation	IEA	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IMP	biological_process
GO:0030522	intracellular receptor si gnaling pathway	IEA	biological_process
GO:0030900	forebrain development	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048514	blood vessel morphogenesi s	IEA	biological_process
GO:0060173	limb development	IEA	biological_process
GO:0060674	placenta blood vessel dev elopment	IEA	biological_process
GO:0060707	trophoblast giant cell di fferentiation	IEA	biological_process
GO:0060849	regulation of transcripti on involved in lymphatic endothelial cell fate com mitment	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0001937	negative regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001972	retinoic acid binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003714	transcription corepressor activity	TAS	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	IDA	molecular_function
GO:0004879	RNA polymerase II transcr iption factor activity, l igand-activated sequence- specific DNA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0006629	lipid metabolic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0010596	negative regulation of en dothelial cell migration	IMP	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0060849	regulation of transcripti on involved in lymphatic endothelial cell fate com mitment	IMP	biological_process

Diseases

Associated diseases	References
Ovarian endometriosis	INFBASE16815388
Endometriosis	INFBASE15299092
Ovarian endometriosis	PMID: 16815388
Unexplained azoospermia	PMID: 26662397

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
15299092	Endometrio sis		Female infertility	PDGFRA PKC beta1 JAK1 Sprouty2 MKK7 COUP-TF2 PGE2EP	Show abstract
16815388	Endometrio sis (ovari an)		Female infertility	PDGFRA PKCbeta1 JAK1 HSP90A COUP-TF2 MOR 17betaHSD2 Sprouty2 and PGE(2)EP3	Show abstract
24423359	Endometrio sis	57 (21 endometr ial and 36 endo metriotic tissu e)		COX-2 COUP-TFII	Show abstract
19001523	Endometrio sis			StAR side chain cleavage P450 3beta-hydroxysteroid-dehydrogenase-2 17-hydroxylase/17-20-lyase aromatase SF1 COUP-TFII WT1	Show abstract