Endometriosis Knowledgebase

Search Result

Gene id

7040

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TGFB1 Gene UCSC Ensembl

Aliases

CED, DPD1, LAP, TGFB, TGFbeta

Gene name

transforming growth factor beta 1

Alternate names

transforming growth factor beta-1, TGF-beta-1, latency-associated peptide, prepro-transforming growth factor beta-1,

Gene location

19q13.2 (16216745: 16030093) Exons: 54 NC_000017.11

Gene summary(Entrez)

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease. [provided by RefSeq, Aug 2016]

OMIM

190180

SNPs

rs1800469

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000681.2   g.41354391A>G
NC_000019.10   g.41354391A>G
NC_000019.9   g.41860296A>G
NG_013091.1   g.14783T>C
NG_013364.1   g.4536T>C
NM_000660.6   c.-1347T>C
NM_030578.3   c.*309T>C

Protein Summary

Protein general information

P01137

Name: Transforming growth factor beta 1 (TGF beta 1) [Cleaved into: Latency associated peptide (LAP)]

Length: 390 Mass: 44,341

Tissue specificity: Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Colocalizes with ASPN in chondrocytes within OA lesions of articular cartilage. {ECO

Sequence

MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPE
AVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLL
SRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSC
DSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPK
VEQLSNMIVRSCKCS

Structural information

Motifs	Cell attachment(244-246)
Interpro:	IPR029034 IPR001839 IPR001111 IPR016319 IPR015615 IPR003939 IPR017948
Prosite:	PS00250 PS51362
Pfam:	PF00019 PF00688
PDB:	1KLA 1KLC 1KLD 3KFD 4KV5 5FFO
PDBsum:	1KLA 1KLC 1KLD 3KFD 4KV5 5FFO
DIP:	5934
MINT:	6806111
STRING:	ENSP00000221930;

Other Databases

GeneCards: TGFB1; Malacards: TGFB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	IDA	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002028	regulation of sodium ion transport	IEA	biological_process
GO:0002062	chondrocyte differentiati on	IDA	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	TAS	biological_process
GO:0002460	adaptive immune response based on somatic recombin ation of immune receptors built from immunoglobuli n superfamily domains	IEA	biological_process
GO:0002513	tolerance induction to se lf antigen	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0003823	antigen binding	IPI	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IDA	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IPI	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IMP	molecular_function
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	ISS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	ISS	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006754	ATP biosynthetic process	IDA	biological_process
GO:0006796	phosphate-containing comp ound metabolic process	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007093	mitotic cell cycle checkp oint	IDA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007182	common-partner SMAD prote in phosphorylation	IDA	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007184	SMAD protein import into nucleus	IDA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007406	negative regulation of ne uroblast proliferation	IEA	biological_process
GO:0007435	salivary gland morphogene sis	IEP	biological_process
GO:0007492	endoderm development	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008156	negative regulation of DN A replication	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008354	germ cell migration	IEA	biological_process
GO:0009314	response to radiation	IEA	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0009817	defense response to fungu s, incompatible interacti on	IEA	biological_process
GO:0009986	cell surface	IMP	cellular_component
GO:0010575	positive regulation of va scular endothelial growth factor production	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IGI	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IGI	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010716	negative regulation of ex tracellular matrix disass embly	IC	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	NAS	biological_process
GO:0010742	macrophage derived foam c ell differentiation	IC	biological_process
GO:0010763	positive regulation of fi broblast migration	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010936	negative regulation of ma crophage cytokine product ion	IDA	biological_process
GO:0014003	oligodendrocyte developme nt	IEA	biological_process
GO:0016049	cell growth	IEA	biological_process
GO:0016202	regulation of striated mu scle tissue development	ISS	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IDA	biological_process
GO:0019049	evasion or tolerance of h ost defenses by virus	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0022408	negative regulation of ce ll-cell adhesion	IDA	biological_process
GO:0030214	hyaluronan catabolic proc ess	IDA	biological_process
GO:0030279	negative regulation of os sification	IEA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030501	positive regulation of bo ne mineralization	IEP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0031065	positive regulation of hi stone deacetylation	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031334	positive regulation of pr otein complex assembly	IDA	biological_process
GO:0031536	positive regulation of ex it from mitosis	IEA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032355	response to estradiol	IDA	biological_process
GO:0032570	response to progesterone	IDA	biological_process
GO:0032667	regulation of interleukin -23 production	IEA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IEA	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IDA	biological_process
GO:0032801	receptor catabolic proces s	IDA	biological_process
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0032943	mononuclear cell prolifer ation	IEA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IMP	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IGI	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0034616	response to laminar fluid shear stress	IEA	biological_process
GO:0034713	type I transforming growt h factor beta receptor bi nding	IPI	molecular_function
GO:0034713	type I transforming growt h factor beta receptor bi nding	IMP	molecular_function
GO:0034714	type III transforming gro wth factor beta receptor binding	IMP	molecular_function
GO:0035066	positive regulation of hi stone acetylation	IEA	biological_process
GO:0035307	positive regulation of pr otein dephosphorylation	IDA	biological_process
GO:0042130	negative regulation of T cell proliferation	IEA	biological_process
GO:0042306	regulation of protein imp ort into nucleus	ISS	biological_process
GO:0042307	positive regulation of pr otein import into nucleus	IDA	biological_process
GO:0042482	positive regulation of od ontogenesis	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042552	myelination	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0043011	myeloid dendritic cell di fferentiation	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043029	T cell homeostasis	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IDA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043539	protein serine/threonine kinase activator activity	IEA	molecular_function
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IDA	biological_process
GO:0043932	ossification involved in bone remodeling	IEP	biological_process
GO:0045066	regulatory T cell differe ntiation	IEA	biological_process
GO:0045216	cell-cell junction organi zation	IDA	biological_process
GO:0045591	positive regulation of re gulatory T cell different iation	IEA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEP	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045930	negative regulation of mi totic cell cycle	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046732	active induction of host immune response by virus	TAS	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048298	positive regulation of is otype switching to IgA is otypes	IDA	biological_process
GO:0048535	lymph node development	ISS	biological_process
GO:0048565	digestive tract developme nt	IEA	biological_process
GO:0048642	negative regulation of sk eletal muscle tissue deve lopment	IDA	biological_process
GO:0048839	inner ear development	IEA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IMP	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050765	negative regulation of ph agocytosis	IEA	biological_process
GO:0050921	positive regulation of ch emotaxis	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051098	regulation of binding	ISS	biological_process
GO:0051101	regulation of DNA binding	ISS	biological_process
GO:0051152	positive regulation of sm ooth muscle cell differen tiation	IEA	biological_process
GO:0051280	negative regulation of re lease of sequestered calc ium ion into cytosol	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0060312	regulation of blood vesse l remodeling	IC	biological_process
GO:0060312	regulation of blood vesse l remodeling	NAS	biological_process
GO:0060325	face morphogenesis	IEA	biological_process
GO:0060364	frontal suture morphogene sis	IEA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060390	regulation of SMAD protei n import into nucleus	IDA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060395	SMAD protein signal trans duction	IBA	biological_process
GO:0060744	mammary gland branching i nvolved in thelarche	IEA	biological_process
GO:0060751	branch elongation involve d in mammary gland duct b ranching	IEA	biological_process
GO:0060762	regulation of branching i nvolved in mammary gland duct morphogenesis	IEA	biological_process
GO:0060965	negative regulation of ge ne silencing by miRNA	IGI	biological_process
GO:0061035	regulation of cartilage d evelopment	IEA	biological_process
GO:0070306	lens fiber cell different iation	IEA	biological_process
GO:0070723	response to cholesterol	IDA	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IGI	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:0085029	extracellular matrix asse mbly	IDA	biological_process
GO:0090190	positive regulation of br anching involved in urete ric bud morphogenesis	IEA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:1900126	negative regulation of hy aluronan biosynthetic pro cess	IDA	biological_process
GO:1901203	positive regulation of ex tracellular matrix assemb ly	IC	biological_process
GO:1901666	positive regulation of NA D+ ADP-ribosyltransferase activity	IDA	biological_process
GO:1903077	negative regulation of pr otein localization to pla sma membrane	IDA	biological_process
GO:1903799	negative regulation of pr oduction of miRNAs involv ed in gene silencing by m iRNA	IGI	biological_process
GO:1903911	positive regulation of re ceptor clustering	IEA	biological_process
GO:2000249	regulation of actin cytos keleton reorganization	IEA	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IDA	biological_process
GO:2000727	positive regulation of ca rdiac muscle cell differe ntiation	IDA	biological_process
GO:1905005	regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS	biological_process
GO:0005902	microvillus	IDA	cellular_component
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0001657	ureteric bud development	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001763	morphogenesis of a branch ing structure	IEA	biological_process
GO:0001775	cell activation	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	IDA	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002028	regulation of sodium ion transport	IEA	biological_process
GO:0002062	chondrocyte differentiati on	IDA	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	TAS	biological_process
GO:0002460	adaptive immune response based on somatic recombin ation of immune receptors built from immunoglobuli n superfamily domains	IEA	biological_process
GO:0002513	tolerance induction to se lf antigen	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0003823	antigen binding	IPI	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IDA	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IPI	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IMP	molecular_function
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IEA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IEA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	ISS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	ISS	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006754	ATP biosynthetic process	IDA	biological_process
GO:0006796	phosphate-containing comp ound metabolic process	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007093	mitotic cell cycle checkp oint	IDA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007182	common-partner SMAD prote in phosphorylation	IDA	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007184	SMAD protein import into nucleus	IEA	biological_process
GO:0007184	SMAD protein import into nucleus	IDA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007406	negative regulation of ne uroblast proliferation	IEA	biological_process
GO:0007435	salivary gland morphogene sis	IEP	biological_process
GO:0007492	endoderm development	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008156	negative regulation of DN A replication	IMP	biological_process
GO:0008283	cell proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008354	germ cell migration	IEA	biological_process
GO:0009314	response to radiation	IEA	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0009817	defense response to fungu s, incompatible interacti on	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IMP	cellular_component
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IGI	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IGI	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010716	negative regulation of ex tracellular matrix disass embly	IC	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IEA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	NAS	biological_process
GO:0010742	macrophage derived foam c ell differentiation	IC	biological_process
GO:0010763	positive regulation of fi broblast migration	IEA	biological_process
GO:0010763	positive regulation of fi broblast migration	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010936	negative regulation of ma crophage cytokine product ion	IDA	biological_process
GO:0014003	oligodendrocyte developme nt	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016049	cell growth	IEA	biological_process
GO:0016202	regulation of striated mu scle tissue development	IEA	biological_process
GO:0016202	regulation of striated mu scle tissue development	ISS	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IDA	biological_process
GO:0019049	evasion or tolerance of h ost defenses by virus	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0022408	negative regulation of ce ll-cell adhesion	IDA	biological_process
GO:0030141	secretory granule	IEA	cellular_component
GO:0030214	hyaluronan catabolic proc ess	IDA	biological_process
GO:0030217	T cell differentiation	IEA	biological_process
GO:0030279	negative regulation of os sification	IEA	biological_process
GO:0030308	negative regulation of ce ll growth	IEA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030501	positive regulation of bo ne mineralization	IEP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030879	mammary gland development	IEA	biological_process
GO:0031065	positive regulation of hi stone deacetylation	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031334	positive regulation of pr otein complex assembly	IDA	biological_process
GO:0031536	positive regulation of ex it from mitosis	IEA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032355	response to estradiol	IDA	biological_process
GO:0032570	response to progesterone	IDA	biological_process
GO:0032667	regulation of interleukin -23 production	IEA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IEA	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IEA	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IDA	biological_process
GO:0032801	receptor catabolic proces s	IDA	biological_process
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0032943	mononuclear cell prolifer ation	IEA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IEA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IMP	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IGI	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0034616	response to laminar fluid shear stress	IEA	biological_process
GO:0034713	type I transforming growt h factor beta receptor bi nding	IPI	molecular_function
GO:0034713	type I transforming growt h factor beta receptor bi nding	IMP	molecular_function
GO:0034714	type III transforming gro wth factor beta receptor binding	IMP	molecular_function
GO:0035066	positive regulation of hi stone acetylation	IEA	biological_process
GO:0035307	positive regulation of pr otein dephosphorylation	IDA	biological_process
GO:0040007	growth	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042110	T cell activation	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042130	negative regulation of T cell proliferation	IEA	biological_process
GO:0042306	regulation of protein imp ort into nucleus	IEA	biological_process
GO:0042306	regulation of protein imp ort into nucleus	ISS	biological_process
GO:0042307	positive regulation of pr otein import into nucleus	IDA	biological_process
GO:0042482	positive regulation of od ontogenesis	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042552	myelination	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0043011	myeloid dendritic cell di fferentiation	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043029	T cell homeostasis	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IDA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043539	protein serine/threonine kinase activator activity	IEA	molecular_function
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IDA	biological_process
GO:0043932	ossification involved in bone remodeling	IEP	biological_process
GO:0045066	regulatory T cell differe ntiation	IEA	biological_process
GO:0045216	cell-cell junction organi zation	IDA	biological_process
GO:0045589	regulation of regulatory T cell differentiation	IEA	biological_process
GO:0045591	positive regulation of re gulatory T cell different iation	IEA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEP	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045930	negative regulation of mi totic cell cycle	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046732	active induction of host immune response by virus	TAS	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048298	positive regulation of is otype switching to IgA is otypes	IDA	biological_process
GO:0048535	lymph node development	IEA	biological_process
GO:0048535	lymph node development	ISS	biological_process
GO:0048565	digestive tract developme nt	IEA	biological_process
GO:0048642	negative regulation of sk eletal muscle tissue deve lopment	IDA	biological_process
GO:0048839	inner ear development	IEA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IMP	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050765	negative regulation of ph agocytosis	IEA	biological_process
GO:0050777	negative regulation of im mune response	IEA	biological_process
GO:0050868	negative regulation of T cell activation	IEA	biological_process
GO:0050921	positive regulation of ch emotaxis	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051098	regulation of binding	IEA	biological_process
GO:0051098	regulation of binding	ISS	biological_process
GO:0051101	regulation of DNA binding	IEA	biological_process
GO:0051101	regulation of DNA binding	ISS	biological_process
GO:0051152	positive regulation of sm ooth muscle cell differen tiation	IEA	biological_process
GO:0051280	negative regulation of re lease of sequestered calc ium ion into cytosol	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0060312	regulation of blood vesse l remodeling	IC	biological_process
GO:0060312	regulation of blood vesse l remodeling	NAS	biological_process
GO:0060325	face morphogenesis	IEA	biological_process
GO:0060364	frontal suture morphogene sis	IEA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IEA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060390	regulation of SMAD protei n import into nucleus	IDA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060395	SMAD protein signal trans duction	IBA	biological_process
GO:0060744	mammary gland branching i nvolved in thelarche	IEA	biological_process
GO:0060751	branch elongation involve d in mammary gland duct b ranching	IEA	biological_process
GO:0060762	regulation of branching i nvolved in mammary gland duct morphogenesis	IEA	biological_process
GO:0060965	negative regulation of ge ne silencing by miRNA	IGI	biological_process
GO:0061035	regulation of cartilage d evelopment	IEA	biological_process
GO:0070306	lens fiber cell different iation	IEA	biological_process
GO:0070723	response to cholesterol	IDA	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	IEA	biological_process
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IGI	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:0085029	extracellular matrix asse mbly	IEA	biological_process
GO:0085029	extracellular matrix asse mbly	IDA	biological_process
GO:0090190	positive regulation of br anching involved in urete ric bud morphogenesis	IEA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:1900126	negative regulation of hy aluronan biosynthetic pro cess	IDA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IEA	biological_process
GO:1901203	positive regulation of ex tracellular matrix assemb ly	IC	biological_process
GO:1901666	positive regulation of NA D+ ADP-ribosyltransferase activity	IDA	biological_process
GO:1903077	negative regulation of pr otein localization to pla sma membrane	IDA	biological_process
GO:1903799	negative regulation of pr oduction of miRNAs involv ed in gene silencing by m iRNA	IGI	biological_process
GO:1903911	positive regulation of re ceptor clustering	IEA	biological_process
GO:2000249	regulation of actin cytos keleton reorganization	IEA	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IDA	biological_process
GO:2000727	positive regulation of ca rdiac muscle cell differe ntiation	IDA	biological_process
GO:1905005	regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS	biological_process
GO:0005902	microvillus	IDA	cellular_component
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0001837	epithelial to mesenchymal transition	IDA	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002062	chondrocyte differentiati on	IDA	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	TAS	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0003823	antigen binding	IPI	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IDA	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IPI	molecular_function
GO:0005114	type II transforming grow th factor beta receptor b inding	IMP	molecular_function
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	ISS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	ISS	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006611	protein export from nucle us	IDA	biological_process
GO:0006754	ATP biosynthetic process	IDA	biological_process
GO:0006796	phosphate-containing comp ound metabolic process	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007093	mitotic cell cycle checkp oint	IDA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007182	common-partner SMAD prote in phosphorylation	IDA	biological_process
GO:0007183	SMAD protein complex asse mbly	IDA	biological_process
GO:0007184	SMAD protein import into nucleus	IDA	biological_process
GO:0007435	salivary gland morphogene sis	IEP	biological_process
GO:0008156	negative regulation of DN A replication	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0009986	cell surface	IMP	cellular_component
GO:0010575	positive regulation of va scular endothelial growth factor production	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IGI	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IGI	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010716	negative regulation of ex tracellular matrix disass embly	IC	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	NAS	biological_process
GO:0010742	macrophage derived foam c ell differentiation	IC	biological_process
GO:0010763	positive regulation of fi broblast migration	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0010800	positive regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0010936	negative regulation of ma crophage cytokine product ion	IDA	biological_process
GO:0016202	regulation of striated mu scle tissue development	ISS	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IDA	biological_process
GO:0019049	evasion or tolerance of h ost defenses by virus	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0022408	negative regulation of ce ll-cell adhesion	IDA	biological_process
GO:0030214	hyaluronan catabolic proc ess	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030334	regulation of cell migrat ion	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030501	positive regulation of bo ne mineralization	IEP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	TAS	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031334	positive regulation of pr otein complex assembly	IDA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032355	response to estradiol	IDA	biological_process
GO:0032570	response to progesterone	IDA	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IDA	biological_process
GO:0032801	receptor catabolic proces s	IDA	biological_process
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IMP	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IGI	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0034713	type I transforming growt h factor beta receptor bi nding	IPI	molecular_function
GO:0034713	type I transforming growt h factor beta receptor bi nding	IMP	molecular_function
GO:0034714	type III transforming gro wth factor beta receptor binding	IMP	molecular_function
GO:0035307	positive regulation of pr otein dephosphorylation	IDA	biological_process
GO:0042306	regulation of protein imp ort into nucleus	ISS	biological_process
GO:0042307	positive regulation of pr otein import into nucleus	IDA	biological_process
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0043117	positive regulation of va scular permeability	IDA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IDA	biological_process
GO:0043932	ossification involved in bone remodeling	IEP	biological_process
GO:0045216	cell-cell junction organi zation	IDA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEP	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045930	negative regulation of mi totic cell cycle	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046732	active induction of host immune response by virus	TAS	biological_process
GO:0048298	positive regulation of is otype switching to IgA is otypes	IDA	biological_process
GO:0048535	lymph node development	ISS	biological_process
GO:0048642	negative regulation of sk eletal muscle tissue deve lopment	IDA	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IMP	biological_process
GO:0050680	negative regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050921	positive regulation of ch emotaxis	IDA	biological_process
GO:0051098	regulation of binding	ISS	biological_process
GO:0051101	regulation of DNA binding	ISS	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0060312	regulation of blood vesse l remodeling	IC	biological_process
GO:0060312	regulation of blood vesse l remodeling	NAS	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060389	pathway-restricted SMAD p rotein phosphorylation	IDA	biological_process
GO:0060390	regulation of SMAD protei n import into nucleus	IDA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060391	positive regulation of SM AD protein import into nu cleus	IDA	biological_process
GO:0060395	SMAD protein signal trans duction	IBA	biological_process
GO:0060965	negative regulation of ge ne silencing by miRNA	IGI	biological_process
GO:0070723	response to cholesterol	IDA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IDA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IGI	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:0085029	extracellular matrix asse mbly	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:1900126	negative regulation of hy aluronan biosynthetic pro cess	IDA	biological_process
GO:1901203	positive regulation of ex tracellular matrix assemb ly	IC	biological_process
GO:1901666	positive regulation of NA D+ ADP-ribosyltransferase activity	IDA	biological_process
GO:1903077	negative regulation of pr otein localization to pla sma membrane	IDA	biological_process
GO:1903799	negative regulation of pr oduction of miRNAs involv ed in gene silencing by m iRNA	IGI	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IDA	biological_process
GO:2000727	positive regulation of ca rdiac muscle cell differe ntiation	IDA	biological_process
GO:1905005	regulation of epithelial to mesenchymal transition involved in endocardial cushion formation	ISS	biological_process
GO:0005902	microvillus	IDA	cellular_component

KEGG pathways

hsa05200  Pathways in cancer
hsa04060  Cytokine-cytokine receptor interaction
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa04068  FoxO signaling pathway
hsa05145  Toxoplasmosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04659  Th17 cell differentiation
hsa04144  Endocytosis
hsa05142  Chagas disease
hsa04390  Hippo signaling pathway
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04110  Cell cycle
hsa05146  Amoebiasis
hsa05140  Leishmaniasis
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa05210  Colorectal cancer
hsa04350  TGF-beta signaling pathway
hsa05144  Malaria
hsa05211  Renal cell carcinoma
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa04672  Intestinal immune network for IgA production

Diseases

Associated diseases	References
Adenomyosis	PMID: 14597251
Albuminuria	PMID: 18293167
Allergic rhinitis	PMID: 15120189
Alveolitis	PMID: 16722148
Alzheimer's disease	PMID: 17986101
Andrological diseases	PMID: 9570740
Ankylosing spondylitis	PMID: 12890863
Aortic aneurysm	PMID: 15944607
Asthenozoospermia	PMID: 17341438
Asthma	PMID: 16387590
Atopic dermatitis	PMID: 11496247
Autoimmune diseases	PMID: 12050565
Camurati-Engelmann disease	KEGG: H00434
Cancer	PMID: 18281501
Celiac disease	PMID: 16287542
Chronic obstructive pulmonary disease (COPD)	PMID: 16456143
Chronic ulcerative colitis	PMID: 17367219
Congenital absence of the vas deferens (CAVD)	PMID: 24958810
Corneal Dystrophies	PMID: 14767644
Crohn's disease	PMID: 11345594
Cystic fibrosis	PMID: 17052957
Dementia	PMID: 16635548
Diabetes	PMID: 12500218
Diabetic nephropathy	PMID: 17173255
Endometrial receptivity	PMID: 11554692
Endometriosis	PMID: 26708185
Endometriosis	PMID: 21546388
Female infertility	PMID: 10357971
Fibrosis	PMID: 12974899
Gential endometriosis	PMID: 16027877
Gingival overgrowth	PMID: 16671880
Glaucoma	PMID: 17570736
Glomerulonephritis	PMID: 15191521
Hemochromatosis	PMID: 15941661
Henoch-Schonlein purpura	PMID: 15257453
Hypersensitivity	PMID: 16179826
Hypodontia	PMID: 15529502
Idiopathic thrombocytopenic purpura	PMID: 14608199
Immune system diseases	PMID: 18321307
Inflammation	PMID: 17989610
inflammatory bowel disease	PMID: 15842590
Juvenile arthritis	PMID: 15170937
Keloid disease	PMID: 15009106
Kidney disease	PMID: 12787424
Leiomyoma	PMID: 14597251
Leydig cell hyperplasia	PMID: 21126344
Liver disease	PMID: 14642613
Male infertility	PMID: 26648778
Endometriosis	INFBASE28438065
External gential endometriosis	INFBASE16027877
Metabolism disorders	PMID: 14557872
Multiple sclerosis	PMID: 16183136
Myopia	PMID: 12601022
Nephropathy	PMID: 15593052
Obesity	PMID: 12649573
Oligozoospermia	PMID: 17341438
Osteoporosis	KEGG: H01593
Pancreatitis	PMID: 15917409
Pemphigus	PMID: 15650893
Periodontitis	PMID: 18321309
Polycystic kidney disease	PMID: 12572925
Endometriosis	INFBASE27130956
Polycystic ovary syndrome (PCOS)	PMID: 20630504
Preeclampsia	PMID: 19474289
Premature birth	PMID: 15592292
Premature ovarian failure ( POF)	PMID: 23858805
Preterm delivery	PMID: 17145371
Primary ovarian insufficiency (POI)	PMID: 22342295
Prostatic hyperplasia	PMID: 16461080
Psoriasis	PMID: 17560118
Pulmonary fibrosis	PMID: 12746254
Recurrent empty follicle syndrome	PMID: 17007665
Recurrent pregnancy loss (RPL)/ Abortion/ Miscarriage/ Recurrent pregnancy failure/Pregnancy loss/ Recurrent miscarriage/ Spontaneous abortion	PMID: 15938776
Repeated implantation failure (RIF)	PMID: 22201617
Respiratory hypersensitivity	PMID: 17071067
Rheumatoid arthritis	PMID: 15794197
Rheumatoid spondylitis	PMID: 15769917
Sarcoidosis	PMID: 11436536
Sertoli cell-only syndrome (SCOS)	PMID: 21126344
Sjogren's syndrome	PMID: 14872501
Spermatogenetic defects	PMID: 4003767
Sudden infant death syndrome (SIDS)	PMID: 16916659
Systemic lupus erythematosus	PMID: 12630751
Systemic sclerosis	PMID: 12117671
Unexplained infertility	PMID: 12607776
Urticaria	PMID: 17237561
Uterine cervical incompetence	PMID: 17766609
Wegener granulomatosis	PMID: 11715070

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26675296	Endometrio sis			55 (47 patient tissues (23 wit h adenomyotic m yometrium, 24 w ith chocolate c yst))		OCT4	Show abstract
27130956	Endometrio sis						Show abstract
28300844	Endometrio sis					IL10 IL27 IL6 and TGFB1	Show abstract
27385728	Endometrio sis						Show abstract
14607563	Endometrio sis			45 (35 patients diagnosed with endometriosis, 10 patients wi thout endometri osis)		TGFbeta1	Show abstract
26577912	Endometrio sis			29 women with e ndometriosis			Show abstract
25207642	Endometrio sis			31 ( 16 control peritoneum and peritoneum pro ne to endometri osis (within Po uch of Douglas) from women wit hout disease, 1 5 peritoneum di stal and adjace nt to endometri osis lesions in women with end ometriosis)	Female infertility		Show abstract
21546388	Endometrio sis					TGFB1	Show abstract
26708185	Endometrio sis			33 (13 women wi th ovarian endo metriosis (case s), 10 eutopic endometria, 10 women with non endometriotic d iseases (contro ls))		HtrA1 TGFb1 pSmad and Ki67	Show abstract
21623988	Endometrio sis	TGFB1-509C/T and 868T/C	Korean	238 (131 women with endometrio sis, 107 withou t endometriosis )	Female infertility	TGFB1	Show abstract
20663498	Endometrio sis	TGFB1 (-509 C/T polymorphism)				TGFB1	Show abstract
16027877	Endometrio sis (Genit al)				Female infertility	IL-1beta IL-2 IL-6 TGFbeta VEGF	Show abstract
8290196	Endometrio sis			52 (26 women wi th endometriosi s, 26 women wit hout endometrio sis)		TGF-beta	Show abstract
17644809	Endometrio sis	-509C/T		260 (72 women w ith deep infilt rating endometr iosis, 95 gynec ological patien ts without symp toms of endomet riosis, 93 heal thy females)		TGF-beta 1	Show abstract
16150151	Endometrio sis			64 (30 women wi th endometriosi s, 34 fertile e umenorrheic wom en )		C-myc TGF-beta1 Bax	Show abstract
17506371	Endometrio sis					TGF-beta1 uPA	Show abstract
21623988	Endometrio sis	TGFB1-509C/T and 868T/C	Korean	238 (131 woman with endometrio sis, 107 withou t endometriosis )			Show abstract
16144297	Endometrio sis			309 (150 patien ts with endomet riosis, 159 non -endometriosis)		TGF-B1	Show abstract
28438065	Endometrio sis					TGFB1 Snail CDH1 VIM PCNA	Show abstract
27130956	Endometrio sis						Show abstract
28397725	Endometrio sis						Show abstract