Endometriosis Knowledgebase

Search Result

Gene id

7041

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TGFB1I1 Gene UCSC Ensembl

Aliases

ARA55, HIC-5, HIC5, TSC-5

Gene name

transforming growth factor beta 1 induced transcript 1

Alternate names

transforming growth factor beta-1-induced transcript 1 protein, androgen receptor coactivator 55 kDa protein, androgen receptor coactivator ARA55, androgen receptor-associated protein of 55 kDa, hydrogen peroxide-inducible clone 5 protein, hydrogen peroxide-in,

Gene location

16p11.2 (31472154: 31477959) Exons: 13 NC_000016.10

Gene summary(Entrez)

This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

OMIM

602353

Protein Summary

Protein general information

O43294

Name: Transforming growth factor beta 1 induced transcript 1 protein (Androgen receptor coactivator 55 kDa protein) (Androgen receptor associated protein of 55 kDa) (Hydrogen peroxide inducible clone 5 protein) (Hic 5)

Length: 461 Mass: 49,814

Tissue specificity: Expressed in platelets, smooth muscle and prostate stromal cells (at protein level). {ECO

Sequence

MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPA
APPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKAS
ATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAK
GLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVT
ALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCREC
FAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERAGKP
YCQPCFLKLFG

Structural information

Protein Domains	LIM (226-285) LIM (286-343) LIM (344-403) LIM (404-461)
Motifs	LD motif(3-15) LD motif(92-104) LD motif(157-168) LD motif(203-215)
Interpro:	IPR017305 IPR001781
Prosite:	PS00478 PS50023
Pfam:	PF00412
DIP:	5931
MINT:	243624
STRING:	ENSP00000378332;

Other Databases

GeneCards: TGFB1I1; Malacards: TGFB1I1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003713	transcription coactivator activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016331	morphogenesis of embryoni c epithelium	IEA	biological_process
GO:0016363	nuclear matrix	IEA	cellular_component
GO:0030511	positive regulation of tr ansforming growth factor beta receptor signaling p athway	IDA	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IDA	biological_process
GO:0030521	androgen receptor signali ng pathway	NAS	biological_process
GO:0030579	ubiquitin-dependent SMAD protein catabolic process	IDA	biological_process
GO:0030855	epithelial cell different iation	IEA	biological_process
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0048495	Roundabout binding	IPI	molecular_function
GO:0050681	androgen receptor binding	IPI	molecular_function
GO:0050681	androgen receptor binding	NAS	molecular_function
GO:0070411	I-SMAD binding	IPI	molecular_function
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003713	transcription coactivator activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016331	morphogenesis of embryoni c epithelium	IEA	biological_process
GO:0016363	nuclear matrix	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030154	cell differentiation	IEA	biological_process
GO:0030511	positive regulation of tr ansforming growth factor beta receptor signaling p athway	IDA	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IDA	biological_process
GO:0030521	androgen receptor signali ng pathway	NAS	biological_process
GO:0030579	ubiquitin-dependent SMAD protein catabolic process	IDA	biological_process
GO:0030855	epithelial cell different iation	IEA	biological_process
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048495	Roundabout binding	IPI	molecular_function
GO:0050681	androgen receptor binding	IPI	molecular_function
GO:0050681	androgen receptor binding	NAS	molecular_function
GO:0070411	I-SMAD binding	IEA	molecular_function
GO:0070411	I-SMAD binding	IPI	molecular_function
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003713	transcription coactivator activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IDA	biological_process
GO:0030511	positive regulation of tr ansforming growth factor beta receptor signaling p athway	IDA	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IDA	biological_process
GO:0030521	androgen receptor signali ng pathway	NAS	biological_process
GO:0030579	ubiquitin-dependent SMAD protein catabolic process	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological_process
GO:0048495	Roundabout binding	IPI	molecular_function
GO:0050681	androgen receptor binding	IPI	molecular_function
GO:0050681	androgen receptor binding	NAS	molecular_function
GO:0070411	I-SMAD binding	IPI	molecular_function
GO:0031012	extracellular matrix	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 19389829

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19389829	Endometrio sis			59 (29 women wi th endometriosi s, 30 women wit hout endometrio sis)			Show abstract