Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 7057
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol THBS1   Gene   UCSC   Ensembl
Aliases THBS, THBS-1, TSP, TSP-1, TSP1
Gene name thrombospondin 1
Alternate names thrombospondin-1, thrombospondin-1p180, thrombospondin-p50,
Gene location 15q14 (39581078: 39598917)     Exons: 22     NC_000015.10
Gene summary(Entrez) The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis. [provided by RefSeq, Jul 2008]
OMIM 188060

Protein Summary

Protein general information P07996  

Name: Thrombospondin 1

Length: 1170  Mass: 129,383

Sequence MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKF
QDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLAT
GQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPED
ILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPS
DSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVT
CGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQ
FGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYR
CECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDD
RDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTD
MDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDP
NWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDT
NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVM
YEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP
Structural information
Protein Domains
Laminin (65-270)
VWFC. (316-373)
TSP (379-429)
TSP (435-490)
TSP (492-547)

Motifs
Cell attachment(926-928)
Interpro:  IPR013320 IPR001881 IPR013032 IPR000742 IPR001791 IPR028499 IPR003367 IPR017897 IPR008859 IPR000884 IPR028974 IPR001007
Prosite:   PS01186 PS50026 PS50092 PS51234 PS51236 PS01208 PS50184

Pfam:  
PF00090 PF02412 PF05735 PF00093

PDB:  
1LSL 1UX6 1Z78 1ZA4 2ERF 2ES3 2OUH 2OUJ 3R6B 5FOE
PDBsum:   1LSL 1UX6 1Z78 1ZA4 2ERF 2ES3 2OUH 2OUJ 3R6B 5FOE

DIP:  
1037
MINT:   6630675
STRING:   ENSP00000260356;
Other Databases GeneCards:  THBS1;  Malacards:  THBS1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000187 activation of MAPK activi
ty
IMP biological_process
GO:0001666 response to hypoxia
NAS biological_process
GO:0001786 phosphatidylserine bindin
g
IDA molecular_function
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IMP biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001948 glycoprotein binding
NAS molecular_function
GO:0001953 negative regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0001953 negative regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0001968 fibronectin binding
IDA molecular_function
GO:0002040 sprouting angiogenesis
IMP biological_process
GO:0002544 chronic inflammatory resp
onse
IEP biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0002581 negative regulation of an
tigen processing and pres
entation of peptide or po
lysaccharide antigen via
MHC class II
IDA biological_process
GO:0002605 negative regulation of de
ndritic cell antigen proc
essing and presentation
IDA biological_process
GO:0005178 integrin binding
IMP molecular_function
GO:0005178 integrin binding
IMP molecular_function
GO:0005509 calcium ion binding
NAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005577 fibrinogen complex
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005783 endoplasmic reticulum
ISS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0006954 inflammatory response
IDA biological_process
GO:0006955 immune response
IEP biological_process
GO:0006986 response to unfolded prot
ein
IEA biological_process
GO:0007050 cell cycle arrest
IDA biological_process
GO:0007155 cell adhesion
NAS biological_process
GO:0008201 heparin binding
IDA molecular_function
GO:0008201 heparin binding
IDA molecular_function
GO:0009749 response to glucose
IDA biological_process
GO:0009897 external side of plasma m
embrane
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0010596 negative regulation of en
dothelial cell migration
IDA biological_process
GO:0010748 negative regulation of pl
asma membrane long-chain
fatty acid transport
IDA biological_process
GO:0010751 negative regulation of ni
tric oxide mediated signa
l transduction
IDA biological_process
GO:0010751 negative regulation of ni
tric oxide mediated signa
l transduction
IDA biological_process
GO:0010754 negative regulation of cG
MP-mediated signaling
IDA biological_process
GO:0010757 negative regulation of pl
asminogen activation
IDA biological_process
GO:0010759 positive regulation of ma
crophage chemotaxis
ISS biological_process
GO:0010763 positive regulation of fi
broblast migration
IDA biological_process
GO:0016477 cell migration
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016529 sarcoplasmic reticulum
ISS cellular_component
GO:0017134 fibroblast growth factor
binding
IDA molecular_function
GO:0018149 peptide cross-linking
IDA biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0030169 low-density lipoprotein p
article binding
IDA molecular_function
GO:0030194 positive regulation of bl
ood coagulation
IDA biological_process
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030335 positive regulation of ce
ll migration
IMP biological_process
GO:0030511 positive regulation of tr
ansforming growth factor
beta receptor signaling p
athway
IDA biological_process
GO:0030823 regulation of cGMP metabo
lic process
IDA biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
TAS cellular_component
GO:0031091 platelet alpha granule
IDA cellular_component
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0032026 response to magnesium ion
IDA biological_process
GO:0032570 response to progesterone
TAS biological_process
GO:0032695 negative regulation of in
terleukin-12 production
IDA biological_process
GO:0032914 positive regulation of tr
ansforming growth factor
beta1 production
ISS biological_process
GO:0034605 cellular response to heat
NAS biological_process
GO:0034976 response to endoplasmic r
eticulum stress
ISS biological_process
GO:0036066 protein O-linked fucosyla
tion
TAS biological_process
GO:0040037 negative regulation of fi
broblast growth factor re
ceptor signaling pathway
IDA biological_process
GO:0042327 positive regulation of ph
osphorylation
IMP biological_process
GO:0042493 response to drug
IEP biological_process
GO:0042535 positive regulation of tu
mor necrosis factor biosy
nthetic process
IDA biological_process
GO:0042802 identical protein binding
NAS molecular_function
GO:0043032 positive regulation of ma
crophage activation
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
IDA biological_process
GO:0043236 laminin binding
IDA molecular_function
GO:0043394 proteoglycan binding
TAS molecular_function
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043537 negative regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043652 engulfment of apoptotic c
ell
IDA biological_process
GO:0045727 positive regulation of tr
anslation
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IMP biological_process
GO:0045766 positive regulation of an
giogenesis
IMP biological_process
GO:0048266 behavioral response to pa
in
ISS biological_process
GO:0050431 transforming growth facto
r beta binding
ISS molecular_function
GO:0050431 transforming growth facto
r beta binding
TAS molecular_function
GO:0050921 positive regulation of ch
emotaxis
IDA biological_process
GO:0051592 response to calcium ion
IDA biological_process
GO:0051592 response to calcium ion
IDA biological_process
GO:0051895 negative regulation of fo
cal adhesion assembly
TAS biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0051918 negative regulation of fi
brinolysis
IDA biological_process
GO:0070051 fibrinogen binding
IDA molecular_function
GO:0070052 collagen V binding
IDA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:1902043 positive regulation of ex
trinsic apoptotic signali
ng pathway via death doma
in receptors
IDA biological_process
GO:2000353 positive regulation of en
dothelial cell apoptotic
process
IDA biological_process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
IDA biological_process
GO:2001027 negative regulation of en
dothelial cell chemotaxis
IDA biological_process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
TAS biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
ISS cellular_component
GO:0000187 activation of MAPK activi
ty
IMP biological_process
GO:0001666 response to hypoxia
NAS biological_process
GO:0001786 phosphatidylserine bindin
g
IDA molecular_function
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IMP biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001948 glycoprotein binding
NAS molecular_function
GO:0001953 negative regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0001953 negative regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0001968 fibronectin binding
IDA molecular_function
GO:0002040 sprouting angiogenesis
IMP biological_process
GO:0002544 chronic inflammatory resp
onse
IEP biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0002581 negative regulation of an
tigen processing and pres
entation of peptide or po
lysaccharide antigen via
MHC class II
IDA biological_process
GO:0002605 negative regulation of de
ndritic cell antigen proc
essing and presentation
IDA biological_process
GO:0005178 integrin binding
IMP molecular_function
GO:0005178 integrin binding
IMP molecular_function
GO:0005509 calcium ion binding
IEA molecular_function
GO:0005509 calcium ion binding
NAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005577 fibrinogen complex
IDA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005783 endoplasmic reticulum
ISS cellular_component
GO:0005783 endoplasmic reticulum
IEA cellular_component
GO:0005783 endoplasmic reticulum
IEA cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0006954 inflammatory response
IEA biological_process
GO:0006954 inflammatory response
IDA biological_process
GO:0006955 immune response
IEP biological_process
GO:0006986 response to unfolded prot
ein
IEA biological_process
GO:0007050 cell cycle arrest
IDA biological_process
GO:0007155 cell adhesion
IEA biological_process
GO:0007155 cell adhesion
IEA biological_process
GO:0007155 cell adhesion
NAS biological_process
GO:0008201 heparin binding
IEA molecular_function
GO:0008201 heparin binding
IEA molecular_function
GO:0008201 heparin binding
IDA molecular_function
GO:0008201 heparin binding
IDA molecular_function
GO:0009749 response to glucose
IDA biological_process
GO:0009897 external side of plasma m
embrane
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0010596 negative regulation of en
dothelial cell migration
IDA biological_process
GO:0010748 negative regulation of pl
asma membrane long-chain
fatty acid transport
IDA biological_process
GO:0010751 negative regulation of ni
tric oxide mediated signa
l transduction
IDA biological_process
GO:0010751 negative regulation of ni
tric oxide mediated signa
l transduction
IDA biological_process
GO:0010754 negative regulation of cG
MP-mediated signaling
IDA biological_process
GO:0010757 negative regulation of pl
asminogen activation
IDA biological_process
GO:0010759 positive regulation of ma
crophage chemotaxis
ISS biological_process
GO:0010763 positive regulation of fi
broblast migration
IDA biological_process
GO:0016477 cell migration
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IEA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016529 sarcoplasmic reticulum
ISS cellular_component
GO:0016529 sarcoplasmic reticulum
IEA cellular_component
GO:0016529 sarcoplasmic reticulum
IEA cellular_component
GO:0017134 fibroblast growth factor
binding
IDA molecular_function
GO:0018149 peptide cross-linking
IDA biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0030169 low-density lipoprotein p
article binding
IDA molecular_function
GO:0030194 positive regulation of bl
ood coagulation
IDA biological_process
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030335 positive regulation of ce
ll migration
IMP biological_process
GO:0030511 positive regulation of tr
ansforming growth factor
beta receptor signaling p
athway
IDA biological_process
GO:0030823 regulation of cGMP metabo
lic process
IDA biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
TAS cellular_component
GO:0031091 platelet alpha granule
IDA cellular_component
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0032026 response to magnesium ion
IDA biological_process
GO:0032570 response to progesterone
TAS biological_process
GO:0032695 negative regulation of in
terleukin-12 production
IDA biological_process
GO:0032914 positive regulation of tr
ansforming growth factor
beta1 production
ISS biological_process
GO:0034605 cellular response to heat
NAS biological_process
GO:0034976 response to endoplasmic r
eticulum stress
ISS biological_process
GO:0036066 protein O-linked fucosyla
tion
TAS biological_process
GO:0040037 negative regulation of fi
broblast growth factor re
ceptor signaling pathway
IDA biological_process
GO:0042327 positive regulation of ph
osphorylation
IMP biological_process
GO:0042493 response to drug
IEP biological_process
GO:0042535 positive regulation of tu
mor necrosis factor biosy
nthetic process
IDA biological_process
GO:0042802 identical protein binding
NAS molecular_function
GO:0043032 positive regulation of ma
crophage activation
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
IDA biological_process
GO:0043236 laminin binding
IDA molecular_function
GO:0043394 proteoglycan binding
TAS molecular_function
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043537 negative regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043652 engulfment of apoptotic c
ell
IDA biological_process
GO:0045727 positive regulation of tr
anslation
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IMP biological_process
GO:0045766 positive regulation of an
giogenesis
IMP biological_process
GO:0048266 behavioral response to pa
in
ISS biological_process
GO:0050431 transforming growth facto
r beta binding
ISS molecular_function
GO:0050431 transforming growth facto
r beta binding
TAS molecular_function
GO:0050840 extracellular matrix bind
ing
IEA molecular_function
GO:0050921 positive regulation of ch
emotaxis
IDA biological_process
GO:0051592 response to calcium ion
IDA biological_process
GO:0051592 response to calcium ion
IDA biological_process
GO:0051895 negative regulation of fo
cal adhesion assembly
TAS biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0051918 negative regulation of fi
brinolysis
IDA biological_process
GO:0070051 fibrinogen binding
IDA molecular_function
GO:0070052 collagen V binding
IDA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:1902043 positive regulation of ex
trinsic apoptotic signali
ng pathway via death doma
in receptors
IDA biological_process
GO:2000353 positive regulation of en
dothelial cell apoptotic
process
IDA biological_process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
IDA biological_process
GO:2001027 negative regulation of en
dothelial cell chemotaxis
IDA biological_process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
TAS biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
ISS cellular_component
GO:0000187 activation of MAPK activi
ty
IMP biological_process
GO:0001666 response to hypoxia
NAS biological_process
GO:0001786 phosphatidylserine bindin
g
IDA molecular_function
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IMP biological_process
GO:0001937 negative regulation of en
dothelial cell proliferat
ion
IDA biological_process
GO:0001948 glycoprotein binding
NAS molecular_function
GO:0001953 negative regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0001953 negative regulation of ce
ll-matrix adhesion
IDA biological_process
GO:0001968 fibronectin binding
IDA molecular_function
GO:0002040 sprouting angiogenesis
IMP biological_process
GO:0002544 chronic inflammatory resp
onse
IEP biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0002581 negative regulation of an
tigen processing and pres
entation of peptide or po
lysaccharide antigen via
MHC class II
IDA biological_process
GO:0002605 negative regulation of de
ndritic cell antigen proc
essing and presentation
IDA biological_process
GO:0005178 integrin binding
IMP molecular_function
GO:0005178 integrin binding
IMP molecular_function
GO:0005509 calcium ion binding
NAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005577 fibrinogen complex
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005783 endoplasmic reticulum
ISS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0005788 endoplasmic reticulum lum
en
TAS cellular_component
GO:0006954 inflammatory response
IDA biological_process
GO:0006955 immune response
IEP biological_process
GO:0007050 cell cycle arrest
IDA biological_process
GO:0007155 cell adhesion
NAS biological_process
GO:0008201 heparin binding
IDA molecular_function
GO:0008201 heparin binding
IDA molecular_function
GO:0009749 response to glucose
IDA biological_process
GO:0009897 external side of plasma m
embrane
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological_process
GO:0010596 negative regulation of en
dothelial cell migration
IDA biological_process
GO:0010748 negative regulation of pl
asma membrane long-chain
fatty acid transport
IDA biological_process
GO:0010751 negative regulation of ni
tric oxide mediated signa
l transduction
IDA biological_process
GO:0010751 negative regulation of ni
tric oxide mediated signa
l transduction
IDA biological_process
GO:0010754 negative regulation of cG
MP-mediated signaling
IDA biological_process
GO:0010757 negative regulation of pl
asminogen activation
IDA biological_process
GO:0010759 positive regulation of ma
crophage chemotaxis
ISS biological_process
GO:0010763 positive regulation of fi
broblast migration
IDA biological_process
GO:0016477 cell migration
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016525 negative regulation of an
giogenesis
IDA biological_process
GO:0016529 sarcoplasmic reticulum
ISS cellular_component
GO:0017134 fibroblast growth factor
binding
IDA molecular_function
GO:0018149 peptide cross-linking
IDA biological_process
GO:0030141 secretory granule
IDA cellular_component
GO:0030169 low-density lipoprotein p
article binding
IDA molecular_function
GO:0030194 positive regulation of bl
ood coagulation
IDA biological_process
GO:0030198 extracellular matrix orga
nization
TAS biological_process
GO:0030335 positive regulation of ce
ll migration
IDA biological_process
GO:0030335 positive regulation of ce
ll migration
IMP biological_process
GO:0030511 positive regulation of tr
ansforming growth factor
beta receptor signaling p
athway
IDA biological_process
GO:0030823 regulation of cGMP metabo
lic process
IDA biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
TAS cellular_component
GO:0031091 platelet alpha granule
IDA cellular_component
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0032026 response to magnesium ion
IDA biological_process
GO:0032570 response to progesterone
TAS biological_process
GO:0032695 negative regulation of in
terleukin-12 production
IDA biological_process
GO:0032914 positive regulation of tr
ansforming growth factor
beta1 production
ISS biological_process
GO:0034605 cellular response to heat
NAS biological_process
GO:0034976 response to endoplasmic r
eticulum stress
ISS biological_process
GO:0036066 protein O-linked fucosyla
tion
TAS biological_process
GO:0040037 negative regulation of fi
broblast growth factor re
ceptor signaling pathway
IDA biological_process
GO:0042327 positive regulation of ph
osphorylation
IMP biological_process
GO:0042493 response to drug
IEP biological_process
GO:0042535 positive regulation of tu
mor necrosis factor biosy
nthetic process
IDA biological_process
GO:0042802 identical protein binding
NAS molecular_function
GO:0043032 positive regulation of ma
crophage activation
IDA biological_process
GO:0043066 negative regulation of ap
optotic process
IDA biological_process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
IDA biological_process
GO:0043236 laminin binding
IDA molecular_function
GO:0043394 proteoglycan binding
TAS molecular_function
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043537 negative regulation of bl
ood vessel endothelial ce
ll migration
IDA biological_process
GO:0043652 engulfment of apoptotic c
ell
IDA biological_process
GO:0045727 positive regulation of tr
anslation
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IMP biological_process
GO:0045766 positive regulation of an
giogenesis
IMP biological_process
GO:0048266 behavioral response to pa
in
ISS biological_process
GO:0050431 transforming growth facto
r beta binding
ISS molecular_function
GO:0050431 transforming growth facto
r beta binding
TAS molecular_function
GO:0050921 positive regulation of ch
emotaxis
IDA biological_process
GO:0051592 response to calcium ion
IDA biological_process
GO:0051592 response to calcium ion
IDA biological_process
GO:0051895 negative regulation of fo
cal adhesion assembly
TAS biological_process
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological_process
GO:0051918 negative regulation of fi
brinolysis
IDA biological_process
GO:0070051 fibrinogen binding
IDA molecular_function
GO:0070052 collagen V binding
IDA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:1902043 positive regulation of ex
trinsic apoptotic signali
ng pathway via death doma
in receptors
IDA biological_process
GO:2000353 positive regulation of en
dothelial cell apoptotic
process
IDA biological_process
GO:2000379 positive regulation of re
active oxygen species met
abolic process
IDA biological_process
GO:2001027 negative regulation of en
dothelial cell chemotaxis
IDA biological_process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
TAS biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0031012 extracellular matrix
ISS cellular_component

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04510  Focal adhesion
hsa04145  Phagosome
hsa04350  TGF-beta signaling pathway
hsa05144  Malaria
hsa05219  Bladder cancer
hsa04115  p53 signaling pathway
hsa04512  ECM-receptor interaction

Diseases

Associated diseases References
Cancer PMID: 17175378
Endometriosis PMID: 21335415
Endometriosis INFBASE12095505
Metabolism disorders PMID: 14557872
Myocardial infarction PMID: 15140581
Polycystic ovary syndrome (PCOS) PMID: 26391700

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
16136892 Endometrio
sis

63 (38 patients
with endometri
osis, 25 specim
ens of endometr
ium were biopsi
ed from women w
ithout endometr
iosis)
TSP-1
VEGF
Show abstract
12095505 Endometrio
sis


VEGF
TSP-1
Show abstract
21335415 Endometrio
sis

96 (58 women wi
th endometriosi
s, 38 control w
omen)
miR-125a
miR-222
VEGF-A
miR-17-5p
TSP-1
Show abstract