Endometriosis Knowledgebase

Search Result

Gene id

7071

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

KLF10 Gene UCSC Ensembl

Aliases

EGR-alpha, EGRA, TIEG, TIEG1

Gene name

Kruppel like factor 10

Alternate names

Krueppel-like factor 10, TGFB-inducible early growth response protein 1, early growth response-alpha, transforming growth factor-beta-inducible early growth response protein 1, zinc finger transcription factor TIEG,

Gene location

8q22.3 (102655901: 102648776) Exons: 5 NC_000008.11

Gene summary(Entrez)

This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]

OMIM

601878

Protein Summary

Protein general information

Q13118

Name: Krueppel-like factor 10 (EGR-alpha) (Transforming growth factor-beta-inducible early growth response protein 1) (TGFB-inducible early growth response protein 1) (TIEG-1)

Length: 480 Mass: 52,555

Sequence

MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEE
NLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKA
QATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKAS
AALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPA
VCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPG
CGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARR
HLSAKKLPNWQMEVSKLNDIALPPTPAPTQ

Structural information

Interpro:	IPR036236 IPR013087
Prosite:	PS00028 PS50157
PDB:	2EPA
PDBsum:	2EPA
MINT:
STRING:	ENSP00000285407;

Other Databases

GeneCards: KLF10; Malacards: KLF10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0001046	core promoter sequence-sp ecific DNA binding	ISS	molecular_function
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0030282	bone mineralization	IEA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	IEA	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0001046	core promoter sequence-sp ecific DNA binding	IEA	molecular_function
GO:0001046	core promoter sequence-sp ecific DNA binding	ISS	molecular_function
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0009267	cellular response to star vation	IEA	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0030282	bone mineralization	IEA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	IEA	biological_process
GO:0042752	regulation of circadian r hythm	IEA	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048511	rhythmic process	IEA	biological_process
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0001046	core promoter sequence-sp ecific DNA binding	ISS	molecular_function
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0009267	cellular response to star vation	ISS	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process

Diseases

Associated diseases	References
Endometriosis	INFBASE27488034

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27488034	Endometrio sis						Show abstract