Endometriosis Knowledgebase

Search Result

Gene id

7079

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TIMP4 Gene UCSC Ensembl

Gene name

TIMP metallopeptidase inhibitor 4

Alternate names

metalloproteinase inhibitor 4, TIMP-4, tissue inhibitor of metalloproteinase 4, tissue inhibitor of metalloproteinases 4,

Gene location

3p25.2 (12159350: 12153067) Exons: 5 NC_000003.12

Gene summary(Entrez)

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling. [provided by RefSeq, Jul 2008]

OMIM

601915

Protein Summary

Protein general information

Q99727

Name: Metalloproteinase inhibitor 4 (Tissue inhibitor of metalloproteinases 4) (TIMP 4)

Length: 224 Mass: 25,503

Tissue specificity: Abundant in heart and present at low levels in many other tissues.

Sequence

MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEI
KQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNH
HYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Structural information

Protein Domains	NTR. (30-156)
Interpro:	IPR001134 IPR001820 IPR008993 IPR027465 IPR030490
Prosite:	PS50189 PS00288
Pfam:	PF00965
STRING:	ENSP00000287814;

Other Databases

GeneCards: TIMP4; Malacards: TIMP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002020	protease binding	IBA	molecular_function
GO:0005578	proteinaceous extracellul ar matrix	IBA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007417	central nervous system de velopment	IEA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0008191	metalloendopeptidase inhi bitor activity	IBA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	NAS	molecular_function
GO:0010033	response to organic subst ance	IBA	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IEA	biological_process
GO:0030017	sarcomere	IEA	cellular_component
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042698	ovulation cycle	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	IBA	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051045	negative regulation of me mbrane protein ectodomain proteolysis	IBA	biological_process
GO:0002020	protease binding	IBA	molecular_function
GO:0004857	enzyme inhibitor activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0007417	central nervous system de velopment	IEA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0008191	metalloendopeptidase inhi bitor activity	IEA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	IBA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	IEA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	NAS	molecular_function
GO:0009725	response to hormone	IEA	biological_process
GO:0010033	response to organic subst ance	IBA	biological_process
GO:0010466	negative regulation of pe ptidase activity	IEA	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IEA	biological_process
GO:0030017	sarcomere	IEA	cellular_component
GO:0030414	peptidase inhibitor activ ity	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042698	ovulation cycle	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	IBA	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051045	negative regulation of me mbrane protein ectodomain proteolysis	IBA	biological_process
GO:0002020	protease binding	IBA	molecular_function
GO:0005578	proteinaceous extracellul ar matrix	IBA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0008191	metalloendopeptidase inhi bitor activity	IBA	molecular_function
GO:0008191	metalloendopeptidase inhi bitor activity	NAS	molecular_function
GO:0010033	response to organic subst ance	IBA	biological_process
GO:0043086	negative regulation of ca talytic activity	IBA	biological_process
GO:0051045	negative regulation of me mbrane protein ectodomain proteolysis	IBA	biological_process

Diseases

Associated diseases	References
Arthritis	PMID: 18301898
Diabetes	PMID: 20581827
Endometrial cancer	PMID: 12798711
Endometriosis	PMID: 21111772
Endometriosis	INFBASE21111772

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21111772	Endometrio sis					PGE2 COX-2 MMP1 MMP2 MMP3 MMP7 MMP9 TIMP1 TIMP2 TIMP3 TIMP4	Show abstract