Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 7097
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol TLR2   Gene   UCSC   Ensembl
Aliases CD282, TIL4
Gene name toll like receptor 2
Alternate names toll-like receptor 2, toll/interleukin-1 receptor-like protein 4,
Gene location 4q31.3 (153684079: 153710642)     Exons: 5     NC_000004.12
Gene summary(Entrez) The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. This protein is a cell-surface protein that can form heterodimers with other TLR family members to recognize conserved molecules derived from microorganisms known as pathogen-associated molecular patterns (PAMPs). Activation of TLRs by PAMPs leads to an up-regulation of signaling pathways to modulate the host's inflammatory response. This gene is also thought to promote apoptosis in response to bacterial lipoproteins. This gene has been implicated in the pathogenesis of several autoimmune diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
OMIM 603028

Protein Summary

Protein general information O60603  

Name: Toll like receptor 2 (Toll/interleukin 1 receptor like protein 4) (CD antigen CD282)

Length: 784  Mass: 89,838

Tissue specificity: Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues.

Sequence MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRC
VNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTK
LQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVE
CLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEE
YLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHS
VTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTL
KTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLH
KRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFC
KLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Structural information
Protein Domains
LRRCT (525-579)
TIR. (639-784)

Motifs
ATG16L1-binding motif.(761-778)
Interpro:  IPR000483 IPR032675 IPR001611 IPR003591 IPR000157 IPR027185 IPR017241
Prosite:   PS51450 PS50104

Pfam:  
PF13855 PF01463 PF01582

PDB:  
1FYW 1FYX 1O77 2Z7X 2Z80
PDBsum:   1FYW 1FYX 1O77 2Z7X 2Z80

DIP:  
35138
MINT:   3000106
STRING:   ENSP00000260010;
Other Databases GeneCards:  TLR2;  Malacards:  TLR2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001530 lipopolysaccharide bindin
g
IDA molecular_function
GO:0001875 lipopolysaccharide recept
or activity
TAS molecular_function
GO:0002374 cytokine secretion involv
ed in immune response
IMP biological_process
GO:0002755 MyD88-dependent toll-like
receptor signaling pathw
ay
TAS biological_process
GO:0004872 receptor activity
IDA molecular_function
GO:0004888 transmembrane signaling r
eceptor activity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005737 cytoplasm
IDA cellular_component
GO:0005794 Golgi apparatus
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0006915 apoptotic process
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007252 I-kappaB phosphorylation
IDA biological_process
GO:0008329 signaling pattern recogni
tion receptor activity
IDA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0010628 positive regulation of ge
ne expression
IMP biological_process
GO:0030177 positive regulation of Wn
t signaling pathway
IMP biological_process
GO:0030670 phagocytic vesicle membra
ne
IEA cellular_component
GO:0031226 intrinsic component of pl
asma membrane
IDA cellular_component
GO:0031663 lipopolysaccharide-mediat
ed signaling pathway
IEA biological_process
GO:0032613 interleukin-10 production
IDA biological_process
GO:0032722 positive regulation of ch
emokine production
IDA biological_process
GO:0032728 positive regulation of in
terferon-beta production
ISS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
ISS biological_process
GO:0032741 positive regulation of in
terleukin-18 production
ISS biological_process
GO:0032755 positive regulation of in
terleukin-6 production
IDA biological_process
GO:0032757 positive regulation of in
terleukin-8 production
IDA biological_process
GO:0032757 positive regulation of in
terleukin-8 production
IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
ISS biological_process
GO:0034123 positive regulation of to
ll-like receptor signalin
g pathway
IDA biological_process
GO:0034134 toll-like receptor 2 sign
aling pathway
IEA biological_process
GO:0035325 Toll-like receptor bindin
g
IPI molecular_function
GO:0035354 Toll-like receptor 1-Toll
-like receptor 2 protein
complex
IDA cellular_component
GO:0038123 toll-like receptor TLR1:T
LR2 signaling pathway
TAS biological_process
GO:0038124 toll-like receptor TLR6:T
LR2 signaling pathway
TAS biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
IDA biological_process
GO:0042495 detection of triacyl bact
erial lipopeptide
IDA biological_process
GO:0042496 detection of diacyl bacte
rial lipopeptide
IDA biological_process
GO:0042497 triacyl lipopeptide bindi
ng
IDA molecular_function
GO:0042834 peptidoglycan binding
IDA molecular_function
GO:0045087 innate immune response
TAS biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
ISS biological_process
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0050707 regulation of cytokine se
cretion
IEA biological_process
GO:0050729 positive regulation of in
flammatory response
IC biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0051770 positive regulation of ni
tric-oxide synthase biosy
nthetic process
ISS biological_process
GO:0071221 cellular response to bact
erial lipopeptide
TAS biological_process
GO:0071223 cellular response to lipo
teichoic acid
IDA biological_process
GO:0071726 cellular response to diac
yl bacterial lipopeptide
IDA biological_process
GO:0071726 cellular response to diac
yl bacterial lipopeptide
IDA biological_process
GO:0071727 cellular response to tria
cyl bacterial lipopeptide
IDA biological_process
GO:0071727 cellular response to tria
cyl bacterial lipopeptide
IDA biological_process
GO:0001530 lipopolysaccharide bindin
g
IDA molecular_function
GO:0001875 lipopolysaccharide recept
or activity
TAS molecular_function
GO:0002224 toll-like receptor signal
ing pathway
IEA biological_process
GO:0002237 response to molecule of b
acterial origin
IEA biological_process
GO:0002374 cytokine secretion involv
ed in immune response
IMP biological_process
GO:0002376 immune system process
IEA biological_process
GO:0002755 MyD88-dependent toll-like
receptor signaling pathw
ay
IEA biological_process
GO:0002755 MyD88-dependent toll-like
receptor signaling pathw
ay
TAS biological_process
GO:0004872 receptor activity
TAS molecular_function
GO:0004872 receptor activity
IDA molecular_function
GO:0004888 transmembrane signaling r
eceptor activity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005737 cytoplasm
IDA cellular_component
GO:0005794 Golgi apparatus
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0006915 apoptotic process
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
IEA biological_process
GO:0006955 immune response
TAS biological_process
GO:0007165 signal transduction
IEA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007252 I-kappaB phosphorylation
IDA biological_process
GO:0008329 signaling pattern recogni
tion receptor activity
IDA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0010628 positive regulation of ge
ne expression
IMP biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0030177 positive regulation of Wn
t signaling pathway
IMP biological_process
GO:0030670 phagocytic vesicle membra
ne
IEA cellular_component
GO:0031226 intrinsic component of pl
asma membrane
IDA cellular_component
GO:0031410 cytoplasmic vesicle
IEA cellular_component
GO:0031663 lipopolysaccharide-mediat
ed signaling pathway
IEA biological_process
GO:0032613 interleukin-10 production
IDA biological_process
GO:0032722 positive regulation of ch
emokine production
IDA biological_process
GO:0032728 positive regulation of in
terferon-beta production
ISS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
ISS biological_process
GO:0032741 positive regulation of in
terleukin-18 production
ISS biological_process
GO:0032755 positive regulation of in
terleukin-6 production
IDA biological_process
GO:0032757 positive regulation of in
terleukin-8 production
IDA biological_process
GO:0032757 positive regulation of in
terleukin-8 production
IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
ISS biological_process
GO:0034123 positive regulation of to
ll-like receptor signalin
g pathway
IDA biological_process
GO:0034134 toll-like receptor 2 sign
aling pathway
IEA biological_process
GO:0035325 Toll-like receptor bindin
g
IPI molecular_function
GO:0035354 Toll-like receptor 1-Toll
-like receptor 2 protein
complex
IDA cellular_component
GO:0038123 toll-like receptor TLR1:T
LR2 signaling pathway
TAS biological_process
GO:0038124 toll-like receptor TLR6:T
LR2 signaling pathway
TAS biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
IDA biological_process
GO:0042495 detection of triacyl bact
erial lipopeptide
IDA biological_process
GO:0042496 detection of diacyl bacte
rial lipopeptide
IDA biological_process
GO:0042497 triacyl lipopeptide bindi
ng
IDA molecular_function
GO:0042834 peptidoglycan binding
IDA molecular_function
GO:0045087 innate immune response
IEA biological_process
GO:0045087 innate immune response
IEA biological_process
GO:0045087 innate immune response
TAS biological_process
GO:0045121 membrane raft
IEA cellular_component
GO:0045121 membrane raft
IDA cellular_component
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
ISS biological_process
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0050707 regulation of cytokine se
cretion
IEA biological_process
GO:0050729 positive regulation of in
flammatory response
IEA biological_process
GO:0050729 positive regulation of in
flammatory response
IC biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0051770 positive regulation of ni
tric-oxide synthase biosy
nthetic process
ISS biological_process
GO:0071221 cellular response to bact
erial lipopeptide
TAS biological_process
GO:0071223 cellular response to lipo
teichoic acid
IDA biological_process
GO:0071726 cellular response to diac
yl bacterial lipopeptide
IDA biological_process
GO:0071726 cellular response to diac
yl bacterial lipopeptide
IDA biological_process
GO:0071727 cellular response to tria
cyl bacterial lipopeptide
IDA biological_process
GO:0071727 cellular response to tria
cyl bacterial lipopeptide
IDA biological_process
GO:0001530 lipopolysaccharide bindin
g
IDA molecular_function
GO:0001875 lipopolysaccharide recept
or activity
TAS molecular_function
GO:0002374 cytokine secretion involv
ed in immune response
IMP biological_process
GO:0002755 MyD88-dependent toll-like
receptor signaling pathw
ay
TAS biological_process
GO:0004872 receptor activity
TAS molecular_function
GO:0004872 receptor activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005737 cytoplasm
IDA cellular_component
GO:0005794 Golgi apparatus
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0006915 apoptotic process
TAS biological_process
GO:0006955 immune response
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007252 I-kappaB phosphorylation
IDA biological_process
GO:0008329 signaling pattern recogni
tion receptor activity
IDA molecular_function
GO:0009986 cell surface
IDA cellular_component
GO:0010628 positive regulation of ge
ne expression
IMP biological_process
GO:0030177 positive regulation of Wn
t signaling pathway
IMP biological_process
GO:0031226 intrinsic component of pl
asma membrane
IDA cellular_component
GO:0032613 interleukin-10 production
IDA biological_process
GO:0032722 positive regulation of ch
emokine production
IDA biological_process
GO:0032728 positive regulation of in
terferon-beta production
ISS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
ISS biological_process
GO:0032741 positive regulation of in
terleukin-18 production
ISS biological_process
GO:0032755 positive regulation of in
terleukin-6 production
IDA biological_process
GO:0032757 positive regulation of in
terleukin-8 production
IDA biological_process
GO:0032757 positive regulation of in
terleukin-8 production
IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
ISS biological_process
GO:0034123 positive regulation of to
ll-like receptor signalin
g pathway
IDA biological_process
GO:0035325 Toll-like receptor bindin
g
IPI molecular_function
GO:0035354 Toll-like receptor 1-Toll
-like receptor 2 protein
complex
IDA cellular_component
GO:0038123 toll-like receptor TLR1:T
LR2 signaling pathway
TAS biological_process
GO:0038124 toll-like receptor TLR6:T
LR2 signaling pathway
TAS biological_process
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
IDA biological_process
GO:0042495 detection of triacyl bact
erial lipopeptide
IDA biological_process
GO:0042496 detection of diacyl bacte
rial lipopeptide
IDA biological_process
GO:0042497 triacyl lipopeptide bindi
ng
IDA molecular_function
GO:0042834 peptidoglycan binding
IDA molecular_function
GO:0045087 innate immune response
TAS biological_process
GO:0045121 membrane raft
IDA cellular_component
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
ISS biological_process
GO:0046982 protein heterodimerizatio
n activity
IDA molecular_function
GO:0050729 positive regulation of in
flammatory response
IC biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0051770 positive regulation of ni
tric-oxide synthase biosy
nthetic process
ISS biological_process
GO:0071221 cellular response to bact
erial lipopeptide
TAS biological_process
GO:0071223 cellular response to lipo
teichoic acid
IDA biological_process
GO:0071726 cellular response to diac
yl bacterial lipopeptide
IDA biological_process
GO:0071726 cellular response to diac
yl bacterial lipopeptide
IDA biological_process
GO:0071727 cellular response to tria
cyl bacterial lipopeptide
IDA biological_process
GO:0071727 cellular response to tria
cyl bacterial lipopeptide
IDA biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05161  Hepatitis B
hsa05145  Toxoplasmosis
hsa05142  Chagas disease
hsa05162  Measles
hsa04145  Phagosome
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa05140  Leishmaniasis
hsa05134  Legionellosis
hsa05144  Malaria

Diseases

Associated diseases References
Amyloidosis PMID: 17013994
Ankylosing spondylitis PMID: 18073264
Asthma PMID: 15007351
Atherosclerosis PMID: 15875151
Atopic dermatitis KEGG: H01358
Behcet's disease PMID: 16901312
Bronchiectasis PMID: 17207025
Colorectal cancer OMIM: 603028
Crohn's disease PMID: 16374251
Diabetes PMID: 17130564
Endometriosis PMID: 26177128
Female infertility PMID: 26114934
Idiopathic male infertility PMID: 26227162
Leukocytospermia PMID: 26227162
Endometriosis associated infertility INFBASE26177128
Endometriosis INFBASE23935397
Otitis media PMID: 17908769
Pelvic inflammatory disease (PID) PMID: 23255565
Periodontitis PMID: 17956467
Polycystic ovary syndrome (PCOS) PMID: 26498675
Preterm delivery PMID: 15516360
Rheumatoid arthritis PMID: 14651524
Sarcoidosis PMID: 16608528
Systemic inflammatory response syndrome PMID: 15753758
Systemic lupus erythematosus PMID: 14651524
Ulcerative colitis PMID: 17565650

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
26177128 Endometrio
sis
TLR2 2258G (guanine)/ A, IFN-gamma (+874T/A)
275 (175 FGTB p
atients and 100
healthy contro
ls )
Female infertility TLR2
TLR4
Show abstract
23935397 Endometrio
sis

80 (40 patients
with endometri
osis, 40 withou
t endometriosis
)
TLR-2
TLR -9
NOD-1
NOD-2
and NOS
Show abstract