Endometriosis Knowledgebase

Search Result

Gene id

7097

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TLR2 Gene UCSC Ensembl

Aliases

CD282, TIL4

Gene name

toll like receptor 2

Alternate names

toll-like receptor 2, toll/interleukin-1 receptor-like protein 4,

Gene location

4q31.3 (153684079: 153710642) Exons: 5 NC_000004.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. This protein is a cell-surface protein that can form heterodimers with other TLR family members to recognize conserved molecules derived from microorganisms known as pathogen-associated molecular patterns (PAMPs). Activation of TLRs by PAMPs leads to an up-regulation of signaling pathways to modulate the host's inflammatory response. This gene is also thought to promote apoptosis in response to bacterial lipoproteins. This gene has been implicated in the pathogenesis of several autoimmune diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

OMIM

603028

Protein Summary

Protein general information

O60603

Name: Toll like receptor 2 (Toll/interleukin 1 receptor like protein 4) (CD antigen CD282)

Length: 784 Mass: 89,838

Tissue specificity: Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues.

Sequence

MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRC
VNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTK
LQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVE
CLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEE
YLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHS
VTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTL
KTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLH
KRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFC
KLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Structural information

Protein Domains	LRRCT (525-579) TIR. (639-784)
Motifs	ATG16L1-binding motif.(761-778)
Interpro:	IPR000483 IPR032675 IPR001611 IPR003591 IPR000157 IPR027185 IPR017241
Prosite:	PS51450 PS50104
Pfam:	PF13855 PF01463 PF01582
PDB:	1FYW 1FYX 1O77 2Z7X 2Z80
PDBsum:	1FYW 1FYX 1O77 2Z7X 2Z80
DIP:	35138
MINT:	3000106
STRING:	ENSP00000260010;

Other Databases

GeneCards: TLR2; Malacards: TLR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001875	lipopolysaccharide recept or activity	TAS	molecular_function
GO:0002374	cytokine secretion involv ed in immune response	IMP	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0004872	receptor activity	IDA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0008329	signaling pattern recogni tion receptor activity	IDA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0030177	positive regulation of Wn t signaling pathway	IMP	biological_process
GO:0030670	phagocytic vesicle membra ne	IEA	cellular_component
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0032613	interleukin-10 production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032741	positive regulation of in terleukin-18 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034134	toll-like receptor 2 sign aling pathway	IEA	biological_process
GO:0035325	Toll-like receptor bindin g	IPI	molecular_function
GO:0035354	Toll-like receptor 1-Toll -like receptor 2 protein complex	IDA	cellular_component
GO:0038123	toll-like receptor TLR1:T LR2 signaling pathway	TAS	biological_process
GO:0038124	toll-like receptor TLR6:T LR2 signaling pathway	TAS	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042495	detection of triacyl bact erial lipopeptide	IDA	biological_process
GO:0042496	detection of diacyl bacte rial lipopeptide	IDA	biological_process
GO:0042497	triacyl lipopeptide bindi ng	IDA	molecular_function
GO:0042834	peptidoglycan binding	IDA	molecular_function
GO:0045087	innate immune response	TAS	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0050707	regulation of cytokine se cretion	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0071221	cellular response to bact erial lipopeptide	TAS	biological_process
GO:0071223	cellular response to lipo teichoic acid	IDA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071727	cellular response to tria cyl bacterial lipopeptide	IDA	biological_process
GO:0071727	cellular response to tria cyl bacterial lipopeptide	IDA	biological_process
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001875	lipopolysaccharide recept or activity	TAS	molecular_function
GO:0002224	toll-like receptor signal ing pathway	IEA	biological_process
GO:0002237	response to molecule of b acterial origin	IEA	biological_process
GO:0002374	cytokine secretion involv ed in immune response	IMP	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	IEA	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004872	receptor activity	IDA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0008329	signaling pattern recogni tion receptor activity	IDA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030177	positive regulation of Wn t signaling pathway	IMP	biological_process
GO:0030670	phagocytic vesicle membra ne	IEA	cellular_component
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IEA	biological_process
GO:0032613	interleukin-10 production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032741	positive regulation of in terleukin-18 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034134	toll-like receptor 2 sign aling pathway	IEA	biological_process
GO:0035325	Toll-like receptor bindin g	IPI	molecular_function
GO:0035354	Toll-like receptor 1-Toll -like receptor 2 protein complex	IDA	cellular_component
GO:0038123	toll-like receptor TLR1:T LR2 signaling pathway	TAS	biological_process
GO:0038124	toll-like receptor TLR6:T LR2 signaling pathway	TAS	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042495	detection of triacyl bact erial lipopeptide	IDA	biological_process
GO:0042496	detection of diacyl bacte rial lipopeptide	IDA	biological_process
GO:0042497	triacyl lipopeptide bindi ng	IDA	molecular_function
GO:0042834	peptidoglycan binding	IDA	molecular_function
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0050707	regulation of cytokine se cretion	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0071221	cellular response to bact erial lipopeptide	TAS	biological_process
GO:0071223	cellular response to lipo teichoic acid	IDA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071727	cellular response to tria cyl bacterial lipopeptide	IDA	biological_process
GO:0071727	cellular response to tria cyl bacterial lipopeptide	IDA	biological_process
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001875	lipopolysaccharide recept or activity	TAS	molecular_function
GO:0002374	cytokine secretion involv ed in immune response	IMP	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004872	receptor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0008329	signaling pattern recogni tion receptor activity	IDA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0030177	positive regulation of Wn t signaling pathway	IMP	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0032613	interleukin-10 production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032741	positive regulation of in terleukin-18 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0035325	Toll-like receptor bindin g	IPI	molecular_function
GO:0035354	Toll-like receptor 1-Toll -like receptor 2 protein complex	IDA	cellular_component
GO:0038123	toll-like receptor TLR1:T LR2 signaling pathway	TAS	biological_process
GO:0038124	toll-like receptor TLR6:T LR2 signaling pathway	TAS	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042495	detection of triacyl bact erial lipopeptide	IDA	biological_process
GO:0042496	detection of diacyl bacte rial lipopeptide	IDA	biological_process
GO:0042497	triacyl lipopeptide bindi ng	IDA	molecular_function
GO:0042834	peptidoglycan binding	IDA	molecular_function
GO:0045087	innate immune response	TAS	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0071221	cellular response to bact erial lipopeptide	TAS	biological_process
GO:0071223	cellular response to lipo teichoic acid	IDA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071726	cellular response to diac yl bacterial lipopeptide	IDA	biological_process
GO:0071727	cellular response to tria cyl bacterial lipopeptide	IDA	biological_process
GO:0071727	cellular response to tria cyl bacterial lipopeptide	IDA	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05161  Hepatitis B
hsa05145  Toxoplasmosis
hsa05142  Chagas disease
hsa05162  Measles
hsa04145  Phagosome
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa05140  Leishmaniasis
hsa05134  Legionellosis
hsa05144  Malaria

Diseases

Associated diseases	References
Amyloidosis	PMID: 17013994
Ankylosing spondylitis	PMID: 18073264
Asthma	PMID: 15007351
Atherosclerosis	PMID: 15875151
Atopic dermatitis	KEGG: H01358
Behcet's disease	PMID: 16901312
Bronchiectasis	PMID: 17207025
Colorectal cancer	OMIM: 603028
Crohn's disease	PMID: 16374251
Diabetes	PMID: 17130564
Endometriosis	PMID: 26177128
Female infertility	PMID: 26114934
Idiopathic male infertility	PMID: 26227162
Leukocytospermia	PMID: 26227162
Endometriosis associated infertility	INFBASE26177128
Endometriosis	INFBASE23935397
Otitis media	PMID: 17908769
Pelvic inflammatory disease (PID)	PMID: 23255565
Periodontitis	PMID: 17956467
Polycystic ovary syndrome (PCOS)	PMID: 26498675
Preterm delivery	PMID: 15516360
Rheumatoid arthritis	PMID: 14651524
Sarcoidosis	PMID: 16608528
Systemic inflammatory response syndrome	PMID: 15753758
Systemic lupus erythematosus	PMID: 14651524
Ulcerative colitis	PMID: 17565650

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26177128	Endometrio sis	TLR2 2258G (guanine)/ A, IFN-gamma (+874T/A)		275 (175 FGTB p atients and 100 healthy contro ls )	Female infertility	TLR2 TLR4	Show abstract
23935397	Endometrio sis			80 (40 patients with endometri osis, 40 withou t endometriosis )		TLR-2 TLR -9 NOD-1 NOD-2 and NOS	Show abstract