Endometriosis Knowledgebase

Search Result

Gene id

7098

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TLR3 Gene UCSC Ensembl

Aliases

CD283, IIAE2

Gene name

toll like receptor 3

Alternate names

toll-like receptor 3,

Gene location

4q35.1 (186069154: 186086723) Exons: 6 NC_000004.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta and pancreas, and is restricted to the dendritic subpopulation of the leukocytes. It recognizes dsRNA associated with viral infection, and induces the activation of NF-kappaB and the production of type I interferons. It may thus play a role in host defense against viruses. Use of alternative polyadenylation sites to generate different length transcripts has been noted for this gene. [provided by RefSeq, Jul 2008]

OMIM

603029

Protein Summary

Protein general information

O15455

Name: Toll like receptor 3 (CD antigen CD283)

Length: 904 Mass: 103,829

Tissue specificity: Expressed at high level in placenta and pancreas. Also detected in CD11c+ immature dendritic cells. Only expressed in dendritic cells and not in other leukocytes, including monocyte precursors. TLR3 is the TLR that is expressed most st

Sequence

MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYS
QLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLI
TLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFG
LFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL
EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMF
TGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQ
EWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDM
LEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHY
LCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQ
TEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDP
LCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK
NSVH

Structural information

Protein Domains	LRRNT (24-51) LRRCT (645-698) TIR. (754-896)
Interpro:	IPR000483 IPR032675 IPR001611 IPR003591 IPR000157 IPR027173
Prosite:	PS51450 PS50104
Pfam:	PF13516 PF13855 PF01582
PDB:	1ZIW 2A0Z 2MK9 2MKA 3ULU 3ULV 5GS0
PDBsum:	1ZIW 2A0Z 2MK9 2MKA 3ULU 3ULV 5GS0
DIP:	29660
MINT:	2840066
STRING:	ENSP00000296795;

Other Databases

GeneCards: TLR3; Malacards: TLR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002282	microglial cell activatio n involved in immune resp onse	IEA	biological_process
GO:0002730	regulation of dendritic c ell cytokine production	IEA	biological_process
GO:0002756	MyD88-independent toll-li ke receptor signaling pat hway	TAS	biological_process
GO:0003725	double-stranded RNA bindi ng	NAS	molecular_function
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0006972	hyperosmotic response	NAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	NAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0008584	male gonad development	IEA	biological_process
GO:0009597	detection of virus	NAS	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	NAS	cellular_component
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034128	negative regulation of My D88-independent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0034138	toll-like receptor 3 sign aling pathway	TAS	biological_process
GO:0034346	positive regulation of ty pe III interferon product ion	IEA	biological_process
GO:0035458	cellular response to inte rferon-beta	IEA	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035690	cellular response to drug	IEA	biological_process
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042742	defense response to bacte rium	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043330	response to exogenous dsR NA	IDA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045356	positive regulation of in terferon-alpha biosynthet ic process	IDA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IMP	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IDA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046330	positive regulation of JN K cascade	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051607	defense response to virus	TAS	biological_process
GO:0070266	necroptotic process	TAS	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEA	biological_process
GO:0071360	cellular response to exog enous dsRNA	IEA	biological_process
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0097527	necroptotic signaling pat hway	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0001774	microglial cell activatio n	IEA	biological_process
GO:0001819	positive regulation of cy tokine production	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0002224	toll-like receptor signal ing pathway	IEA	biological_process
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002282	microglial cell activatio n involved in immune resp onse	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002730	regulation of dendritic c ell cytokine production	IEA	biological_process
GO:0002756	MyD88-independent toll-li ke receptor signaling pat hway	IEA	biological_process
GO:0002756	MyD88-independent toll-li ke receptor signaling pat hway	TAS	biological_process
GO:0003723	RNA binding	IEA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IEA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IEA	molecular_function
GO:0003725	double-stranded RNA bindi ng	NAS	molecular_function
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0004872	receptor activity	IEA	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006952	defense response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006972	hyperosmotic response	NAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	NAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0008584	male gonad development	IEA	biological_process
GO:0009597	detection of virus	NAS	biological_process
GO:0009615	response to virus	IEA	biological_process
GO:0010008	endosome membrane	IEA	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	NAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0032481	positive regulation of ty pe I interferon productio n	IEA	biological_process
GO:0032722	positive regulation of ch emokine production	IEA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	IEA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IEA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034128	negative regulation of My D88-independent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0034138	toll-like receptor 3 sign aling pathway	IEA	biological_process
GO:0034138	toll-like receptor 3 sign aling pathway	TAS	biological_process
GO:0034346	positive regulation of ty pe III interferon product ion	IEA	biological_process
GO:0035458	cellular response to inte rferon-beta	IEA	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035690	cellular response to drug	IEA	biological_process
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042742	defense response to bacte rium	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043330	response to exogenous dsR NA	IEA	biological_process
GO:0043330	response to exogenous dsR NA	IEA	biological_process
GO:0043330	response to exogenous dsR NA	IDA	biological_process
GO:0043331	response to dsRNA	IEA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045356	positive regulation of in terferon-alpha biosynthet ic process	IDA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IMP	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IDA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046330	positive regulation of JN K cascade	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0051607	defense response to virus	TAS	biological_process
GO:0070266	necroptotic process	TAS	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEA	biological_process
GO:0071359	cellular response to dsRN A	IEA	biological_process
GO:0071360	cellular response to exog enous dsRNA	IEA	biological_process
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0097527	necroptotic signaling pat hway	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002224	toll-like receptor signal ing pathway	TAS	biological_process
GO:0002756	MyD88-independent toll-li ke receptor signaling pat hway	TAS	biological_process
GO:0003725	double-stranded RNA bindi ng	NAS	molecular_function
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006972	hyperosmotic response	NAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007250	activation of NF-kappaB-i nducing kinase activity	NAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0009597	detection of virus	NAS	biological_process
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	NAS	cellular_component
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034123	positive regulation of to ll-like receptor signalin g pathway	IDA	biological_process
GO:0034128	negative regulation of My D88-independent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0034138	toll-like receptor 3 sign aling pathway	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0036020	endolysosome membrane	TAS	cellular_component
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042742	defense response to bacte rium	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043330	response to exogenous dsR NA	IDA	biological_process
GO:0045078	positive regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045356	positive regulation of in terferon-alpha biosynthet ic process	IDA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IMP	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IDA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0051607	defense response to virus	TAS	biological_process
GO:0070266	necroptotic process	TAS	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0097527	necroptotic signaling pat hway	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component

KEGG pathways

hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05160  Hepatitis C
hsa04620  Toll-like receptor signaling pathway
hsa04217  Necroptosis
PTHR44599:SF1  Toll receptor signaling pathway

Diseases

Associated diseases	References
Asthma	PMID: 14987294
Endometrial cancer	PMID: 18775079
Endometriosis	PMID: 18775079
Endometrial cancer	INFBASE18775079
Endometriosis	INFBASE18775079
Stevens-Johnson syndrome	PMID: 17314152

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18775079	Endometrio sis					TLR3 TLR4	Show abstract