Endometriosis Knowledgebase

Search Result

Gene id

7099

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TLR4 Gene UCSC Ensembl

Aliases

ARMD10, CD284, TLR-4, TOLL

Gene name

toll like receptor 4

Alternate names

toll-like receptor 4, hToll, homolog of Drosophila toll,

Gene location

9q33.1 (117704174: 117717490) Exons: 4 NC_000009.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

OMIM

603030

SNPs

rs4986790

Strand:    Allele origin: G(germline)/A(germline)  Allele change: A/G/T   Mutation type: snp

CM000671.2   g.117713024A>G
CM000671.2   g.117713024A>T
NC_000009.11   g.120475302A>G
NC_000009.12   g.117713024A>G
NC_000009.12   g.117713024A>T
NG_011475.1   g.13843A>G
NG_011475.1   g.13843A>T
NM_003266.3   c.776A>G
NM_003266.3   c.776A>T
NM_138554.3   c.896A>G
NM_138554.3   c.896A>T
NM_138554.4   c.896A>G
NM_138554.4   c.896A>T
NM_138557.2   c.296A>G
NM_138557.2   c.296A>T
NP_003257.1   p.Asp259Gly
NP_003257.1   p.Asp259Val
NP_612564.1   p.Asp299Gly
NP_612564.1   p.Asp299Val
NP_612567.1   p.Asp99Gly
NP_612567.1   p.Asp99Val
XP_005252239.1   p.Asp297Gly
Clinical Significance: Benign

Protein Summary

Protein general information

O00206

Name: Toll like receptor 4 (hToll) (CD antigen CD284)

Length: 839 Mass: 95,680

Tissue specificity: Highly expressed in placenta, spleen and peripheral blood leukocytes. Detected in monocytes, macrophages, dendritic cells and several types of T-cells. {ECO

Sequence

MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFF
SFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLK
TLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKE
IRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSL
EFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLI
YLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVL
NMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYD
AFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFE
YEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEG
TVGTGCNWQEATSI

Structural information

Protein Domains	LRRCT (579-629) TIR. (672-818)
Interpro:	IPR000483 IPR032675 IPR001611 IPR003591 IPR000157 IPR027168
Prosite:	PS51450 PS50104
Pfam:	PF13516 PF13855 PF01582
PDB:	2Z62 2Z63 2Z65 2Z66 3FXI 3UL7 3UL8 3UL9 3ULA 4G8A
PDBsum:	2Z62 2Z63 2Z65 2Z66 3FXI 3UL7 3UL8 3UL9 3ULA 4G8A
DIP:	34769
MINT:	3981856
STRING:	ENSP00000363089;

Other Databases

GeneCards: TLR4; Malacards: TLR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activi ty	ISS	biological_process
GO:0001530	lipopolysaccharide bindin g	NAS	molecular_function
GO:0001530	lipopolysaccharide bindin g	IMP	molecular_function
GO:0001875	lipopolysaccharide recept or activity	IDA	molecular_function
GO:0002224	toll-like receptor signal ing pathway	IBA	biological_process
GO:0002322	B cell proliferation invo lved in immune response	IEA	biological_process
GO:0002537	nitric oxide production i nvolved in inflammatory r esponse	IEA	biological_process
GO:0002730	regulation of dendritic c ell cytokine production	IEA	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0002756	MyD88-independent toll-li ke receptor signaling pat hway	TAS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010572	positive regulation of pl atelet activation	ISS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0014002	astrocyte development	IEA	biological_process
GO:0016046	detection of fungus	NAS	biological_process
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IGI	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IC	biological_process
GO:0032497	detection of lipopolysacc haride	IDA	biological_process
GO:0032609	interferon-gamma producti on	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	ISS	biological_process
GO:0032700	negative regulation of in terleukin-17 production	ISS	biological_process
GO:0032707	negative regulation of in terleukin-23 production	ISS	biological_process
GO:0032715	negative regulation of in terleukin-6 production	ISS	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032727	positive regulation of in terferon-alpha production	ISS	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032729	positive regulation of in terferon-gamma production	ISS	biological_process
GO:0032732	positive regulation of in terleukin-1 production	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034128	negative regulation of My D88-independent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0034142	toll-like receptor 4 sign aling pathway	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0042088	T-helper 1 type immune re sponse	NAS	biological_process
GO:0042116	macrophage activation	IMP	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042535	positive regulation of tu mor necrosis factor biosy nthetic process	IDA	biological_process
GO:0042742	defense response to bacte rium	TAS	biological_process
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IDA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IEA	biological_process
GO:0045416	positive regulation of in terleukin-8 biosynthetic process	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046330	positive regulation of JN K cascade	IEA	biological_process
GO:0046696	lipopolysaccharide recept or complex	IDA	cellular_component
GO:0046696	lipopolysaccharide recept or complex	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050702	interleukin-1 beta secret ion	ISS	biological_process
GO:0050707	regulation of cytokine se cretion	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050829	defense response to Gram- negative bacterium	IBA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0060729	intestinal epithelial str ucture maintenance	ISS	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	IEA	biological_process
GO:0070266	necroptotic process	TAS	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070430	positive regulation of nu cleotide-binding oligomer ization domain containing 1 signaling pathway	IEA	biological_process
GO:0070434	positive regulation of nu cleotide-binding oligomer ization domain containing 2 signaling pathway	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	ISS	biological_process
GO:0071223	cellular response to lipo teichoic acid	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0000187	activation of MAPK activi ty	ISS	biological_process
GO:0001530	lipopolysaccharide bindin g	NAS	molecular_function
GO:0001530	lipopolysaccharide bindin g	IMP	molecular_function
GO:0001875	lipopolysaccharide recept or activity	IDA	molecular_function
GO:0002218	activation of innate immu ne response	IEA	biological_process
GO:0002224	toll-like receptor signal ing pathway	IBA	biological_process
GO:0002322	B cell proliferation invo lved in immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002537	nitric oxide production i nvolved in inflammatory r esponse	IEA	biological_process
GO:0002730	regulation of dendritic c ell cytokine production	IEA	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	IEA	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0002756	MyD88-independent toll-li ke receptor signaling pat hway	TAS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006954	inflammatory response	IBA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007252	I-kappaB phosphorylation	IEA	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0009617	response to bacterium	IEA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010572	positive regulation of pl atelet activation	IEA	biological_process
GO:0010572	positive regulation of pl atelet activation	ISS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0014002	astrocyte development	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016046	detection of fungus	NAS	biological_process
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IGI	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IC	biological_process
GO:0032497	detection of lipopolysacc haride	IDA	biological_process
GO:0032609	interferon-gamma producti on	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	ISS	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IEA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	ISS	biological_process
GO:0032707	negative regulation of in terleukin-23 production	IEA	biological_process
GO:0032707	negative regulation of in terleukin-23 production	ISS	biological_process
GO:0032715	negative regulation of in terleukin-6 production	IEA	biological_process
GO:0032715	negative regulation of in terleukin-6 production	ISS	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0032722	positive regulation of ch emokine production	IEA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032727	positive regulation of in terferon-alpha production	IEA	biological_process
GO:0032727	positive regulation of in terferon-alpha production	ISS	biological_process
GO:0032728	positive regulation of in terferon-beta production	IEA	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IEA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	ISS	biological_process
GO:0032732	positive regulation of in terleukin-1 production	IEA	biological_process
GO:0032732	positive regulation of in terleukin-1 production	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IEA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IEA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0032874	positive regulation of st ress-activated MAPK casca de	IEA	biological_process
GO:0034128	negative regulation of My D88-independent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0034142	toll-like receptor 4 sign aling pathway	IEA	biological_process
GO:0034142	toll-like receptor 4 sign aling pathway	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0042088	T-helper 1 type immune re sponse	NAS	biological_process
GO:0042116	macrophage activation	IEA	biological_process
GO:0042116	macrophage activation	IMP	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042535	positive regulation of tu mor necrosis factor biosy nthetic process	IDA	biological_process
GO:0042742	defense response to bacte rium	TAS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological_process
GO:0045359	positive regulation of in terferon-beta biosyntheti c process	IEA	biological_process
GO:0045416	positive regulation of in terleukin-8 biosynthetic process	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046330	positive regulation of JN K cascade	IEA	biological_process
GO:0046696	lipopolysaccharide recept or complex	IEA	cellular_component
GO:0046696	lipopolysaccharide recept or complex	IDA	cellular_component
GO:0046696	lipopolysaccharide recept or complex	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050671	positive regulation of ly mphocyte proliferation	IEA	biological_process
GO:0050702	interleukin-1 beta secret ion	IEA	biological_process
GO:0050702	interleukin-1 beta secret ion	ISS	biological_process
GO:0050707	regulation of cytokine se cretion	IEA	biological_process
GO:0050727	regulation of inflammator y response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050829	defense response to Gram- negative bacterium	IEA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IEA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IBA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	IEA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0060729	intestinal epithelial str ucture maintenance	IEA	biological_process
GO:0060729	intestinal epithelial str ucture maintenance	ISS	biological_process
GO:0060907	positive regulation of ma crophage cytokine product ion	IEA	biological_process
GO:0070266	necroptotic process	TAS	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070430	positive regulation of nu cleotide-binding oligomer ization domain containing 1 signaling pathway	IEA	biological_process
GO:0070434	positive regulation of nu cleotide-binding oligomer ization domain containing 2 signaling pathway	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	ISS	biological_process
GO:0071223	cellular response to lipo teichoic acid	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	IEA	biological_process
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0000187	activation of MAPK activi ty	ISS	biological_process
GO:0001530	lipopolysaccharide bindin g	NAS	molecular_function
GO:0001530	lipopolysaccharide bindin g	IMP	molecular_function
GO:0001875	lipopolysaccharide recept or activity	IDA	molecular_function
GO:0002224	toll-like receptor signal ing pathway	IBA	biological_process
GO:0002755	MyD88-dependent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0002756	MyD88-independent toll-li ke receptor signaling pat hway	TAS	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological_process
GO:0007252	I-kappaB phosphorylation	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010008	endosome membrane	TAS	cellular_component
GO:0010572	positive regulation of pl atelet activation	ISS	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016046	detection of fungus	NAS	biological_process
GO:0031226	intrinsic component of pl asma membrane	IDA	cellular_component
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IGI	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IC	biological_process
GO:0032497	detection of lipopolysacc haride	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	ISS	biological_process
GO:0032700	negative regulation of in terleukin-17 production	ISS	biological_process
GO:0032707	negative regulation of in terleukin-23 production	ISS	biological_process
GO:0032715	negative regulation of in terleukin-6 production	ISS	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032727	positive regulation of in terferon-alpha production	ISS	biological_process
GO:0032728	positive regulation of in terferon-beta production	ISS	biological_process
GO:0032729	positive regulation of in terferon-gamma production	ISS	biological_process
GO:0032732	positive regulation of in terleukin-1 production	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	ISS	biological_process
GO:0034128	negative regulation of My D88-independent toll-like receptor signaling pathw ay	TAS	biological_process
GO:0034142	toll-like receptor 4 sign aling pathway	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0035666	TRIF-dependent toll-like receptor signaling pathwa y	TAS	biological_process
GO:0042088	T-helper 1 type immune re sponse	NAS	biological_process
GO:0042116	macrophage activation	IMP	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042535	positive regulation of tu mor necrosis factor biosy nthetic process	IDA	biological_process
GO:0042742	defense response to bacte rium	TAS	biological_process
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IDA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045416	positive regulation of in terleukin-8 biosynthetic process	IDA	biological_process
GO:0045671	negative regulation of os teoclast differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0046696	lipopolysaccharide recept or complex	IDA	cellular_component
GO:0046696	lipopolysaccharide recept or complex	IDA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050702	interleukin-1 beta secret ion	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0050829	defense response to Gram- negative bacterium	IBA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IC	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051770	positive regulation of ni tric-oxide synthase biosy nthetic process	ISS	biological_process
GO:0060729	intestinal epithelial str ucture maintenance	ISS	biological_process
GO:0070266	necroptotic process	TAS	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0071222	cellular response to lipo polysaccharide	ISS	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:1900227	positive regulation of NL RP3 inflammasome complex assembly	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05145  Toxoplasmosis
hsa04621  NOD-like receptor signaling pathway
hsa05142  Chagas disease
hsa05162  Measles
hsa04145  Phagosome
hsa04066  HIF-1 signaling pathway
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa05140  Leishmaniasis
hsa04217  Necroptosis
hsa05133  Pertussis
hsa04064  NF-kappa B signaling pathway
hsa05134  Legionellosis
hsa05132  Salmonella infection
hsa05144  Malaria
hsa05130  Pathogenic Escherichia coli infection
PTHR44568:SF1  Toll receptor signaling pathway

Diseases

Associated diseases	References
Ankylosing spondylitis	PMID: 15647432
Arthritis	PMID: 12846053
Asthma	PMID: 15007351
Atherosclerosis	PMID: 17849054
Atopy	PMID: 16142747
Celiac disease	PMID: 17927684
Chronic obstructive pulmonary disease (COPD)	PMID: 16219455
Crohn's disease	PMID: 15655821
Cystic fibrosis	PMID: 16830219
Diabetes	PMID: 18298826
Endometrial cancer	PMID: 18775079
Endometriosis	PMID: 23252918
Endotoxemia	PMID: 18307517
Guillain-Barre syndrome	PMID: 15081257
Hypersensitivity	PMID: 18001295
Idiopathic male infertility	PMID: 26227162
Inflammatory bowel disease	PMID: 15905704
Leukocytospermia	PMID: 26227162
Macular degeneration	KEGG: H00821
Endometriosis associated infertility	INFBASE26177128
Endometrial cancer	INFBASE18775079
Endometriosis	INFBASE18775079
Mental disorders	PMID: 20889312
Multiple sclerosis	PMID: 12622779
Myocardial infarction	PMID: 15864121
Osteoporosis	PMID: 17381056
Otitis media	PMID: 17908769
Pancreatitis	PMID: 17124436
Parkinson's disease	PMID: 17052657
Pelvic inflammatory disease (PID)	PMID: 23255565
Periodontitis	PMID: 15875057
Polycystic ovary syndrome (PCOS)	PMID: 27367829
Pregnancy loss	PMID: 16982657
Preterm delivery	PMID: 15516360
Rheumatoid arthritis	PMID: 14651524
Sarcoidosis	PMID: 16487240
Schizophrenia	PMID: 19571808
Scleroderma	PMID: 17100974
Systemic inflammatory hyporesponsiveness	PMID: 14610481
Systemic lupus erythematosus	PMID: 14651524
Tubal factor infertility	PMID: 20598754
Tubal factor infertility	PMID: 20598754
Ulcerative colitis	PMID: 16085746

PubMed references

PMID	Condition	Mutation	Population details	Infertility_type	Associated_genes	Abstract
23252918	Endometrio sis		37 patients wit h endometrial c ysts		COX-2 mPGES-1 and TLR4	Show abstract
21214494	Endometrio sis	TLR4 A896G polymorphism (rs4986790)	400 (200 surgic ally confirmed cases of endome triosis, 200 he althy women)		TLR4	Show abstract
18775079	Endometrio sis				TLR3 TLR4	Show abstract
26177128	Endometrio sis	TLR2 2258G (guanine)/ A, IFN-gamma (+874T/A)	275 (175 FGTB p atients and 100 healthy contro ls )	Female infertility	TLR2 TLR4	Show abstract