Endometriosis Knowledgebase

Search Result

Gene id

718

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

C3 Gene UCSC Ensembl

Aliases

AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p

Gene name

complement C3

Alternate names

complement C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3a anaphylatoxin, acylation-stimulating protein cleavage product, complement component 3, complement component C3a, complement component C3b, epididymis secretory sperm binding pr,

Gene location

19p13.3 (6720681: 6677834) Exons: 41 NC_000019.10

Gene summary(Entrez)

Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients. [provided by RefSeq, Nov 2015]

OMIM

120700

Protein Summary

Protein general information

P01024

Name: Complement C3 (C3 and PZP like alpha 2 macroglobulin domain containing protein 1) [Cleaved into: Complement C3 beta chain; C3 beta c (C3bc); Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein (ASP) (C3adesArg); Complement C3b alph

Length: 1663 Mass: 187,148

Tissue specificity: Plasma. The acylation stimulating protein (ASP) is expressed in adipocytes and released into the plasma during both the fasting and postprandial periods. {ECO

Sequence

MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTV
LTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIF
TVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
EYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVF
VTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVG
NSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDF
IPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAARRRRSVQL
TEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSN
LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTV
MQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTE
SETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK
KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVI
HQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMV
FQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHA
KAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGV
DRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDE
VQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLG
AFTESMVVFGCPN

Structural information

Protein Domains	Anaphylatoxin-like. (693-728) NTR. (1518-1661)
Interpro:	IPR009048 IPR011626 IPR002890 IPR011625 IPR000020 IPR018081 IPR001840 IPR013783 IPR001599 IPR019742 IPR019565 IPR001134 IPR018933 IPR008930 IPR008993
Prosite:	PS00477 PS01177 PS01178 PS50189
Pfam:	PF00207 PF07678 PF01835 PF07703 PF07677 PF01821 PF01759 PF10569
PDB:	1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W
PDBsum:	1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W
DIP:	35180
MINT:	5003988
STRING:	ENSP00000245907;

Other Databases

GeneCards: C3; Malacards: C3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001798	positive regulation of ty pe IIa hypersensitivity	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001970	positive regulation of ac tivation of membrane atta ck complex	IEA	biological_process
GO:0002507	tolerance induction	IEA	biological_process
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004866	endopeptidase inhibitor a ctivity	IEA	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0006956	complement activation	IMP	biological_process
GO:0006956	complement activation	TAS	biological_process
GO:0006957	complement activation, al ternative pathway	TAS	biological_process
GO:0006958	complement activation, cl assical pathway	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010828	positive regulation of gl ucose transport	IDA	biological_process
GO:0010828	positive regulation of gl ucose transport	IDA	biological_process
GO:0010866	regulation of triglycerid e biosynthetic process	IDA	biological_process
GO:0010884	positive regulation of li pid storage	IDA	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IEA	biological_process
GO:0030449	regulation of complement activation	TAS	biological_process
GO:0031715	C5L2 anaphylatoxin chemot actic receptor binding	IDA	molecular_function
GO:0032026	response to magnesium ion	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0048037	cofactor binding	IEA	molecular_function
GO:0048639	positive regulation of de velopmental growth	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:2000427	positive regulation of ap optotic cell clearance	IMP	biological_process
GO:0001798	positive regulation of ty pe IIa hypersensitivity	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001970	positive regulation of ac tivation of membrane atta ck complex	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002507	tolerance induction	IEA	biological_process
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004866	endopeptidase inhibitor a ctivity	IEA	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0006956	complement activation	IEA	biological_process
GO:0006956	complement activation	IEA	biological_process
GO:0006956	complement activation	IMP	biological_process
GO:0006956	complement activation	TAS	biological_process
GO:0006957	complement activation, al ternative pathway	IEA	biological_process
GO:0006957	complement activation, al ternative pathway	TAS	biological_process
GO:0006958	complement activation, cl assical pathway	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007596	blood coagulation	IEA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010828	positive regulation of gl ucose transport	IDA	biological_process
GO:0010828	positive regulation of gl ucose transport	IDA	biological_process
GO:0010866	regulation of triglycerid e biosynthetic process	IDA	biological_process
GO:0010884	positive regulation of li pid storage	IDA	biological_process
GO:0010951	negative regulation of en dopeptidase activity	IEA	biological_process
GO:0030449	regulation of complement activation	TAS	biological_process
GO:0031715	C5L2 anaphylatoxin chemot actic receptor binding	IDA	molecular_function
GO:0032026	response to magnesium ion	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032570	response to progesterone	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0048037	cofactor binding	IEA	molecular_function
GO:0048639	positive regulation of de velopmental growth	IEA	biological_process
GO:0050766	positive regulation of ph agocytosis	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:2000427	positive regulation of ap optotic cell clearance	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	TAS	biological_process
GO:0006956	complement activation	IMP	biological_process
GO:0006956	complement activation	TAS	biological_process
GO:0006957	complement activation, al ternative pathway	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010828	positive regulation of gl ucose transport	IDA	biological_process
GO:0010828	positive regulation of gl ucose transport	IDA	biological_process
GO:0010866	regulation of triglycerid e biosynthetic process	IDA	biological_process
GO:0010884	positive regulation of li pid storage	IDA	biological_process
GO:0030449	regulation of complement activation	TAS	biological_process
GO:0031715	C5L2 anaphylatoxin chemot actic receptor binding	IDA	molecular_function
GO:0045745	positive regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component
GO:2000427	positive regulation of ap optotic cell clearance	IMP	biological_process

KEGG pathways

hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05203  Viral carcinogenesis
hsa05142  Chagas disease
hsa04145  Phagosome
hsa05140  Leishmaniasis
hsa05133  Pertussis
hsa04610  Complement and coagulation cascades
hsa05134  Legionellosis
hsa05322  Systemic lupus erythematosus
hsa05150  Staphylococcus aureus infection

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 15648851
Asthma	PMID: 15278436
Atypical hemolytic uremic syndrome	KEGG: H01434
Cirrhosis	PMID: 4029969
Endometriosis	PMID: 2332059
Follicular development	PMID: 25595538
Hypertrophy	PMID: 8395174
Inflammatory bowel disease	PMID: 16570073
Macular degeneration	PMID: 17634448, KEGG: H00821
Male infertility	PMID: 26791536
Ovarian endometriosis	PMID: 22633261
Ovarian hyperstimulation syndrome (OHSS)	PMID: 21697218
Polycystic ovary syndrome (PCOS)	PMID: 18206145
Systemic lupus erythematosus	PMID: 11801636
Endometriosis	INFBASE27137486
Ovarian�endometriosis	INFBASE22633261
Endometriosis associated infertility	INFBASE19263878
Female infertility	INFBASE6208058

PubMed references

PMID	Condition	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
2332059	Endometrio sis					Show abstract
9102363	Endometrio sis				AMY1 AMY2 ACP1 PGM1 SOD-A ESD GLO1 C3 TF PGM1	Show abstract
21733505	Endometrio sis	Puerto Rican	384 (147 contro ls without endo metriosis or in fertility, 214 subjects with endometriosis, with or without infertility, 7 2 subjects with endometriosis without known i nfertility prob lems, 73 subjec ts with endomet riosis-associat ed infertility)	Female infertility	LOXL4 C3	Show abstract
22633261	Endometrio sis (ovari an)					Show abstract
6208058	Endometrio sis		102 patients wi th Wright's-Gie msa and Papanic olaou stains		PGF2 alpha PGE2 C3c C4	Show abstract
9102363	Endometrio sis				AMY1 AMY2 ACP1 PGM1 SOD-A ESD GLO1 C3 TF PGM1	Show abstract
19263878	Endometrio sis		52 (26 fertile women, 26 infer tile ones)	Female infertility	TF C3serum amyloid P-component alpha-1-antitrypsin and clusterin	Show abstract
27137486	Endometrio sis		23 (20 endometr iosis patients, 3 healthy cont rols)		AZGP1 C3	Show abstract