Endometriosis Knowledgebase

Search Result

Gene id

726

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CAPN5 Gene UCSC Ensembl

Aliases

ADNIV, HTRA3, VRNI, nCL-3

Gene name

calpain 5

Alternate names

calpain-5, calpain htra-3, new calpain 3, testis tissue sperm-binding protein Li 91mP,

Gene location

11q13.5 (77066944: 77126154) Exons: 15 NC_000011.10

Gene summary(Entrez)

Calpains are calcium-dependent cysteine proteases involved in signal transduction in a variety of cellular processes. A functional calpain protein consists of an invariant small subunit and 1 of a family of large subunits. CAPN5 is one of the large subunits. Unlike some of the calpains, CAPN5 and CAPN6 lack a calmodulin-like domain IV. Because of the significant similarity to Caenorhabditis elegans sex determination gene tra-3, CAPN5 is also called as HTRA3. [provided by RefSeq, Jul 2008]

OMIM

602537

Protein Summary

Protein general information

O15484

Name: Calpain 5 (EC 3.4.22. ) (Calpain htra 3) (New calpain 3) (nCL 3)

Length: 640 Mass: 73,169

Tissue specificity: Expressed in many tissues. Strong expression in the photoreceptor cells of the retina, with a punctate pattern of labeling over the nuclei and inner segments with less expression along the other segments and outer plexiform layer. {ECO

Sequence

MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICEDPRLFVDGISSHDLHQ
GQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQLIYC
HSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDFANDETKRNQLFERMLKVHSRG
GLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSE
EWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLHGAWTLHEDPRQNRGG
GCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSI
YINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCRELRLDEPPHTCWSSLCGYPQLVTQVHVLG
AAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKAD
PDNLQALHTLHLRDRNSRQPSNLPGTVAVHILSSTSLMAV

Structural information

Protein Domains	Calpain (26-343) C2. (518-619)
Interpro:	IPR033884 IPR000008 IPR033883 IPR022684 IPR022682 IPR022683 IPR000169 IPR001300
Prosite:	PS50203 PS00139
Pfam:	PF01067 PF00648
CDD:	cd04046 cd00214 cd00044
STRING:	ENSP00000278559;

Other Databases

GeneCards: CAPN5; Malacards: CAPN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001553	luteinization	IEA	biological_process
GO:0004198	calcium-dependent cystein e-type endopeptidase acti vity	IEA	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0060014	granulosa cell differenti ation	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001553	luteinization	IEA	biological_process
GO:0004198	calcium-dependent cystein e-type endopeptidase acti vity	IEA	molecular_function
GO:0004198	calcium-dependent cystein e-type endopeptidase acti vity	TAS	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008234	cysteine-type peptidase a ctivity	IEA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0060014	granulosa cell differenti ation	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0004198	calcium-dependent cystein e-type endopeptidase acti vity	TAS	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Autosomal dominant neovascular inflammatory vitreoretinopathy	KEGG: H01798, OMIM: 602537
Diabetes	PMID: 16396936
Endometriosis	PMID: 18829447
Polycystic ovary syndrome (PCOS)	PMID: 16396936
Endometriosis	INFBASE18829447

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18829447	Endometrio sis			50 (30 controls , 20 subjects w ith endometrios is)		Calpain5 HOXA10	Show abstract