Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 727
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol C5   Gene   UCSC   Ensembl
Aliases C5D, C5a, C5b, CPAMD4, ECLZB
Gene name complement C5
Alternate names complement C5, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, C5a anaphylatoxin, anaphylatoxin C5a analog, complement component 5, prepro-C5,
Gene location 9q33.2 (121075173: 120952334)     Exons: 47     NC_000009.12
Gene summary(Entrez) This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the C5 alpha chain, C5 beta chain, C5a anaphylatoxin and C5b. The C5 protein is comprised of the C5 alpha and beta chains, which are linked by a disulfide bridge. Cleavage of the alpha chain by a convertase enzyme results in the formation of the C5a anaphylatoxin, which possesses potent spasmogenic and chemotactic activity, and the C5b macromolecular cleavage product, a subunit of the membrane attack complex (MAC). Mutations in this gene cause complement component 5 deficiency, a disease characterized by recurrent bacterial infections. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
OMIM 120900

Protein Summary

Protein general information P01031  

Name: Complement C5 (C3 and PZP like alpha 2 macroglobulin domain containing protein 4) [Cleaved into: Complement C5 beta chain; Complement C5 alpha chain; C5a anaphylatoxin; Complement C5 alpha' chain]

Length: 1676  Mass: 188,305

Sequence MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSS
ENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPDQSVKVRVYSLND
DLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLP
HFSVSIEPEYNFIGYKNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQV
KDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTDAPDLPEENQARE
GYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQS
INIPVTQNMVPSSRLLVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILRP
RRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLG
RLHMKTLLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFL
EMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKR
ILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLIEKQKLKKKLK
EGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQ
PIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLS
EEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVST
GFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMD
ISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFV
KYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPR
DTTCSSCQAFLANLDEFAEDIFLNGC
Structural information
Protein Domains
Anaphylatoxin-like. (698-732)
NTR. (1532-1676)
Interpro:  IPR009048 IPR011626 IPR002890 IPR011625 IPR000020 IPR018081 IPR001840 IPR013783 IPR001599 IPR001134 IPR018933 IPR008930 IPR008993
Prosite:   PS01177 PS01178 PS50189

Pfam:  
PF00207 PF07678 PF01835 PF07703 PF07677 PF01821 PF01759

PDB:  
1CFA 1KJS 1XWE 3CU7 3HQA 3HQB 3KLS 3KM9 3PRX 3PVM 4A5W 4E0S 4P39 4UU9 5HCC 5HCD 5HCE 5I5K
PDBsum:   1CFA 1KJS 1XWE 3CU7 3HQA 3HQB 3KLS 3KM9 3PRX 3PVM 4A5W 4E0S 4P39 4UU9 5HCC 5HCD 5HCE 5I5K
STRING:   ENSP00000223642;
Other Databases GeneCards:  C5;  Malacards:  C5

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000187 activation of MAPK activi
ty
TAS biological_process
GO:0001701 in utero embryonic develo
pment
IEA biological_process
GO:0004866 endopeptidase inhibitor a
ctivity
IEA molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005579 membrane attack complex
IEA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006950 response to stress
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006956 complement activation
TAS biological_process
GO:0006957 complement activation, al
ternative pathway
IEA biological_process
GO:0006958 complement activation, cl
assical pathway
IEA biological_process
GO:0007166 cell surface receptor sig
naling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0008009 chemokine activity
TAS molecular_function
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010760 negative regulation of ma
crophage chemotaxis
IDA biological_process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0019835 cytolysis
IEA biological_process
GO:0030449 regulation of complement
activation
TAS biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0060326 cell chemotaxis
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0090197 positive regulation of ch
emokine secretion
IDA biological_process
GO:0098779 mitophagy in response to
mitochondrial depolarizat
ion
IGI biological_process
GO:0000187 activation of MAPK activi
ty
TAS biological_process
GO:0001701 in utero embryonic develo
pment
IEA biological_process
GO:0002376 immune system process
IEA biological_process
GO:0004866 endopeptidase inhibitor a
ctivity
IEA molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005579 membrane attack complex
IEA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006950 response to stress
TAS biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006956 complement activation
IEA biological_process
GO:0006956 complement activation
TAS biological_process
GO:0006957 complement activation, al
ternative pathway
IEA biological_process
GO:0006958 complement activation, cl
assical pathway
IEA biological_process
GO:0007166 cell surface receptor sig
naling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0008009 chemokine activity
TAS molecular_function
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010760 negative regulation of ma
crophage chemotaxis
IDA biological_process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0019835 cytolysis
IEA biological_process
GO:0030449 regulation of complement
activation
TAS biological_process
GO:0045087 innate immune response
IEA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0060326 cell chemotaxis
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0090197 positive regulation of ch
emokine secretion
IDA biological_process
GO:0098779 mitophagy in response to
mitochondrial depolarizat
ion
IGI biological_process
GO:0000187 activation of MAPK activi
ty
TAS biological_process
GO:0005102 receptor binding
TAS molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006950 response to stress
TAS biological_process
GO:0006954 inflammatory response
TAS biological_process
GO:0006956 complement activation
TAS biological_process
GO:0007166 cell surface receptor sig
naling pathway
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0008009 chemokine activity
TAS molecular_function
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010760 negative regulation of ma
crophage chemotaxis
IDA biological_process
GO:0030449 regulation of complement
activation
TAS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0090197 positive regulation of ch
emokine secretion
IDA biological_process
GO:0098779 mitophagy in response to
mitochondrial depolarizat
ion
IGI biological_process

KEGG pathways

hsa05168  Herpes simplex infection
hsa05133  Pertussis
hsa04610  Complement and coagulation cascades
hsa05322  Systemic lupus erythematosus
hsa05150  Staphylococcus aureus infection
hsa05020  Prion diseases

Diseases

Associated diseases References
Asthma PMID: 15278436
C5 deficiency OMIM: 120900
Endometriosis PMID: 24316322
Female infertility PMID: 24316322
Macular degeneration PMID: 17634448
Rheumatoid arthritis PMID: 17880261
Endometriosis INFBASE24316322

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24316322 Endometrio
sis



Show abstract