Endometriosis Knowledgebase

Search Result

Gene id

7349

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

UCN Gene UCSC Ensembl

Aliases

UI, UROC

Gene name

urocortin

Alternate names

urocortin, prepro-urocortin, urocortin, preproprotein,

Gene location

2p23.3 (27308444: 27307399) Exons: 2 NC_000002.12

Gene summary(Entrez)

This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family. The encoded preproprotein is proteolytically processed to generate the mature peptide, an endogenous ligand for both corticotropin-releasing factor receptor 1 and corticotropin-releasing factor receptor 2. In the brain this peptide may be responsible for the effects of stress on appetite. This peptide may also play a role in mood disorders, neurodegeneration, and skeletal system disorders. In spite of the gene family name similarity, the product of this gene has no sequence similarity to urotensin-2. [provided by RefSeq, Feb 2016]

OMIM

600945

Protein Summary

Protein general information

P55089

Name: Urocortin

Length: 124 Mass: 13,458

Tissue specificity: Keratinocytes in epidermis and the outer and inner root sheaths of hair follicles, epithelium of sebaceous and sweat glands, erector pili muscle, cutaneous blood vessel walls, cutaneous nerves and dermal mononuclear cells (PubMed

Sequence

MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGT
AGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK

Structural information

Interpro:	IPR018446 IPR000187 IPR003620
Prosite:	PS00511
Pfam:	PF00473
PDB:	2RMF 3N96
PDBsum:	2RMF 3N96
STRING:	ENSP00000296099;

Other Databases

GeneCards: UCN; Malacards: UCN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001964	startle response	IEA	biological_process
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007218	neuropeptide signaling pa thway	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0008306	associative learning	IEA	biological_process
GO:0009060	aerobic respiration	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0030157	pancreatic juice secretio n	IEA	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030425	dendrite	IEA	cellular_component
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0031064	negative regulation of hi stone deacetylation	IEA	biological_process
GO:0031175	neuron projection develop ment	IEA	biological_process
GO:0032099	negative regulation of ap petite	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0034199	activation of protein kin ase A activity	IEA	biological_process
GO:0035176	social behavior	IEA	biological_process
GO:0035483	gastric emptying	IEA	biological_process
GO:0042756	drinking behavior	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IEA	biological_process
GO:0043196	varicosity	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043679	axon terminus	IEA	cellular_component
GO:0045727	positive regulation of tr anslation	IEA	biological_process
GO:0045740	positive regulation of DN A replication	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	IEA	biological_process
GO:0045792	negative regulation of ce ll size	IEA	biological_process
GO:0045909	positive regulation of va sodilation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046811	histone deacetylase inhib itor activity	IEA	molecular_function
GO:0046888	negative regulation of ho rmone secretion	IEA	biological_process
GO:0048265	response to pain	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051430	corticotropin-releasing h ormone receptor 1 binding	IEA	molecular_function
GO:0051431	corticotropin-releasing h ormone receptor 2 binding	IEA	molecular_function
GO:0051461	positive regulation of co rticotropin secretion	IEA	biological_process
GO:0051966	regulation of synaptic tr ansmission, glutamatergic	IEA	biological_process
GO:0060452	positive regulation of ca rdiac muscle contraction	IEA	biological_process
GO:0060455	negative regulation of ga stric acid secretion	IEA	biological_process
GO:0060547	negative regulation of ne crotic cell death	IEA	biological_process
GO:0090280	positive regulation of ca lcium ion import	IEA	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:2000252	negative regulation of fe eding behavior	IEA	biological_process
GO:2000987	positive regulation of be havioral fear response	IEA	biological_process
GO:0001664	G-protein coupled recepto r binding	IEA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001964	startle response	IEA	biological_process
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007218	neuropeptide signaling pa thway	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0007611	learning or memory	IEA	biological_process
GO:0007631	feeding behavior	IEA	biological_process
GO:0008306	associative learning	IEA	biological_process
GO:0009060	aerobic respiration	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0030157	pancreatic juice secretio n	IEA	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030425	dendrite	IEA	cellular_component
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0031064	negative regulation of hi stone deacetylation	IEA	biological_process
GO:0031175	neuron projection develop ment	IEA	biological_process
GO:0032099	negative regulation of ap petite	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IEA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IEA	biological_process
GO:0034199	activation of protein kin ase A activity	IEA	biological_process
GO:0035176	social behavior	IEA	biological_process
GO:0035483	gastric emptying	IEA	biological_process
GO:0042756	drinking behavior	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IEA	biological_process
GO:0043196	varicosity	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043679	axon terminus	IEA	cellular_component
GO:0045727	positive regulation of tr anslation	IEA	biological_process
GO:0045740	positive regulation of DN A replication	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	IEA	biological_process
GO:0045792	negative regulation of ce ll size	IEA	biological_process
GO:0045909	positive regulation of va sodilation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046811	histone deacetylase inhib itor activity	IEA	molecular_function
GO:0046888	negative regulation of ho rmone secretion	IEA	biological_process
GO:0048265	response to pain	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051430	corticotropin-releasing h ormone receptor 1 binding	IEA	molecular_function
GO:0051431	corticotropin-releasing h ormone receptor 2 binding	IEA	molecular_function
GO:0051461	positive regulation of co rticotropin secretion	IEA	biological_process
GO:0051966	regulation of synaptic tr ansmission, glutamatergic	IEA	biological_process
GO:0060452	positive regulation of ca rdiac muscle contraction	IEA	biological_process
GO:0060455	negative regulation of ga stric acid secretion	IEA	biological_process
GO:0060547	negative regulation of ne crotic cell death	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0090280	positive regulation of ca lcium ion import	IEA	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:2000252	negative regulation of fe eding behavior	IEA	biological_process
GO:2000987	positive regulation of be havioral fear response	IEA	biological_process
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process

Diseases

Associated diseases	References
Deafness	PMID: 14960712
Endometriosis	PMID: 21454316
Endometriosis	INFBASE21289256
Ovarian endometriosis	INFBASE17766605
Endometriosis (ovarian)	INFBASE17766605
Obesity	PMID: 11836334
Ovarian endometriosis	PMID: 17766605
Ovarian endometriosis	PMID: 17766605

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
23638035	Endometrio sis	26 (16 women wi th endometriosi s, 10 healthy w omen)	CRH UCN CRHR1 CRHR2	Show abstract
21289256	Endometrio sis		CRH Ucn	Show abstract
21454316	Endometrio sis	119 (39 patient s with endometr ioma, 39 women with endometrio sis, 41 patient s without endom etriosis)	Ucn 2	Show abstract
17766605	Endometrio sis (ovari an)	80 (40 women wi th ovarian endo metrioma, 40 wo men with benign , nonendometrio tic ovarian cys ts)	urocortin	Show abstract
27567427	Endometrio sis	48 (22 ovarian endometrioma, 2 6 deep infiltra ting endometrio sis)	CRH UCN UCN2 CRHR2 PLA2G2A COX2	Show abstract