Endometriosis Knowledgebase

Search Result

Gene id

7392

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

USF2 Gene UCSC Ensembl

Aliases

FIP, bHLHb12

Gene name

upstream transcription factor 2, c-fos interacting

Alternate names

upstream stimulatory factor 2, c-fos interacting protein, class B basic helix-loop-helix protein 12, major late transcription factor 2,

Gene location

19q13.12 (35268977: 35279820) Exons: 12 NC_000019.10

Gene summary(Entrez)

This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes. [provided by RefSeq, Mar 2016]

OMIM

600390

Protein Summary

Protein general information

Q15853

Name: Upstream stimulatory factor 2 (Class B basic helix loop helix protein 12) (bHLHb12) (FOS interacting protein) (FIP) (Major late transcription factor 2) (Upstream transcription factor 2)

Length: 346 Mass: 36,955

Tissue specificity: Ubiquitous.

Sequence

MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGG
QVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPF
SNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKI
DGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ

Structural information

Protein Domains	bHLH. (235-290)
Interpro:	IPR011598
Prosite:	PS50888
Pfam:	PF00010
CDD:	cd00083
STRING:	ENSP00000222305;

Other Databases

GeneCards: USF2; Malacards: USF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000430	regulation of transcripti on from RNA polymerase II promoter by glucose	IC	biological_process
GO:0000432	positive regulation of tr anscription from RNA poly merase II promoter by glu cose	ISS	biological_process
GO:0000432	positive regulation of tr anscription from RNA poly merase II promoter by glu cose	IMP	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IMP	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IMP	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0019086	late viral transcription	IC	biological_process
GO:0019086	late viral transcription	IC	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0055088	lipid homeostasis	ISS	biological_process
GO:0000430	regulation of transcripti on from RNA polymerase II promoter by glucose	IC	biological_process
GO:0000432	positive regulation of tr anscription from RNA poly merase II promoter by glu cose	IEA	biological_process
GO:0000432	positive regulation of tr anscription from RNA poly merase II promoter by glu cose	ISS	biological_process
GO:0000432	positive regulation of tr anscription from RNA poly merase II promoter by glu cose	IMP	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IMP	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IMP	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0019086	late viral transcription	IC	biological_process
GO:0019086	late viral transcription	IC	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0055088	lipid homeostasis	IEA	biological_process
GO:0055088	lipid homeostasis	ISS	biological_process
GO:0000430	regulation of transcripti on from RNA polymerase II promoter by glucose	IC	biological_process
GO:0000432	positive regulation of tr anscription from RNA poly merase II promoter by glu cose	ISS	biological_process
GO:0000432	positive regulation of tr anscription from RNA poly merase II promoter by glu cose	IMP	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IMP	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IMP	biological_process
GO:0019086	late viral transcription	IC	biological_process
GO:0019086	late viral transcription	IC	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043425	bHLH transcription factor binding	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0055088	lipid homeostasis	ISS	biological_process

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 16870626
Endometriosis	PMID: 26453052
Endometriosis	INFBASE18165439

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26453052	Endometrio sis			86(37 women und ergoing diagnos tic laparoscopy for endometrio sis associated with pain and/o r infertility, 49 women withou t endometriosis undergoing lap aroscopy for tu bal ligation or hysterectomy f or a benign non -endometrial gy necologic condi tion (controls)	Female infertility	USF2a ER GPER and USF2b	Show abstract
18165439	Endometrio sis					USF2 SF-1 StAR aromatase	Show abstract