Endometriosis Knowledgebase

Search Result

Gene id

7424

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

VEGFC Gene UCSC Ensembl

Aliases

Flt4-L, LMPH1D, VRP

Gene name

vascular endothelial growth factor C

Alternate names

vascular endothelial growth factor C, FLT4 ligand DHM, vascular endothelial growth factor-related protein,

Gene location

4q34.3 (176792744: 176683533) Exons: 7 NC_000004.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors. [provided by RefSeq, Apr 2014]

OMIM

601528

Protein Summary

Protein general information

P49767

Name: Vascular endothelial growth factor C (VEGF C) (Flt4 ligand) (Flt4 L) (Vascular endothelial growth factor related protein) (VRP)

Length: 419 Mass: 46,883

Tissue specificity: Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.

Sequence

MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYP
EYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNT
FFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSII
RRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKK
FHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS

Structural information

Interpro:	IPR004153 IPR029034 IPR023581 IPR000072
Prosite:	PS00249 PS50278
Pfam:	PF03128 PF00341
CDD:	cd00135
PDB:	2X1W 2X1X 4BSK
PDBsum:	2X1W 2X1X 4BSK
DIP:	5738
STRING:	ENSP00000280193;

Other Databases

GeneCards: VEGFC; Malacards: VEGFC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006929	substrate-dependent cell migration	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016331	morphogenesis of embryoni c epithelium	IEA	biological_process
GO:0030947	regulation of vascular en dothelial growth factor r eceptor signaling pathway	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031954	positive regulation of pr otein autophosphorylation	IEA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0043185	vascular endothelial grow th factor receptor 3 bind ing	IEA	molecular_function
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050714	positive regulation of pr otein secretion	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0050930	induction of positive che motaxis	IDA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IDA	biological_process
GO:1901492	positive regulation of ly mphangiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006929	substrate-dependent cell migration	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009887	animal organ morphogenesi s	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016331	morphogenesis of embryoni c epithelium	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030947	regulation of vascular en dothelial growth factor r eceptor signaling pathway	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031954	positive regulation of pr otein autophosphorylation	IEA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0043185	vascular endothelial grow th factor receptor 3 bind ing	IEA	molecular_function
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050714	positive regulation of pr otein secretion	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0050930	induction of positive che motaxis	IDA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IDA	biological_process
GO:1901492	positive regulation of ly mphangiogenesis	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0006929	substrate-dependent cell migration	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050930	induction of positive che motaxis	IDA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04668  TNF signaling pathway

Diseases

Associated diseases	References
Anoxia	PMID: 20215856
Chorioamnionitis	PMID: 20673868
Endometriosis	PMID: 23585340
Angiogenesis in endometriosis	INFBASE23334337
Endometriosis	INFBASE23334337
Lymphedema	PMID: 19002718
Ovarian cancer	PMID: 20628624
Preeclampsia	PMID: 20223440

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23334337	Endometrio sis			15 (10 peritone al endometriosi s, 5 controls)	Female infertility	VEGF-A VEGF-B VEGF-C	Show abstract
23585340	Endometrio sis			79 (37 control, 42 endometrios is)		NRP-1 NRP-2 VEGF-D VEGF-C	Show abstract