Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 7424
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol VEGFC   Gene   UCSC   Ensembl
Aliases Flt4-L, LMPH1D, VRP
Gene name vascular endothelial growth factor C
Alternate names vascular endothelial growth factor C, FLT4 ligand DHM, vascular endothelial growth factor-related protein,
Gene location 4q34.3 (176792744: 176683533)     Exons: 7     NC_000004.12
Gene summary(Entrez) The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. The encoded protein promotes angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. The proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors. [provided by RefSeq, Apr 2014]
OMIM 601528

Protein Summary

Protein general information P49767  

Name: Vascular endothelial growth factor C (VEGF C) (Flt4 ligand) (Flt4 L) (Vascular endothelial growth factor related protein) (VRP)

Length: 419  Mass: 46,883

Tissue specificity: Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.

Sequence MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYP
EYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNT
FFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSII
RRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKK
FHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS
Structural information
Interpro:  IPR004153 IPR029034 IPR023581 IPR000072
Prosite:   PS00249 PS50278

Pfam:  
PF03128 PF00341
CDD:   cd00135

PDB:  
2X1W 2X1X 4BSK
PDBsum:   2X1W 2X1X 4BSK

DIP:  
5738
STRING:   ENSP00000280193;
Other Databases GeneCards:  VEGFC;  Malacards:  VEGFC

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001525 angiogenesis
IEA biological_process
GO:0001954 positive regulation of ce
ll-matrix adhesion
IEA biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
IEA biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006929 substrate-dependent cell
migration
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0008083 growth factor activity
IEA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0008285 negative regulation of ce
ll proliferation
IEA biological_process
GO:0009887 animal organ morphogenesi
s
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016331 morphogenesis of embryoni
c epithelium
IEA biological_process
GO:0030947 regulation of vascular en
dothelial growth factor r
eceptor signaling pathway
IEA biological_process
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0031954 positive regulation of pr
otein autophosphorylation
IEA biological_process
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0042493 response to drug
IEA biological_process
GO:0043185 vascular endothelial grow
th factor receptor 3 bind
ing
IEA molecular_function
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IEA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0045776 negative regulation of bl
ood pressure
IEA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0050679 positive regulation of ep
ithelial cell proliferati
on
IEA biological_process
GO:0050714 positive regulation of pr
otein secretion
IEA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IEA biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0050930 induction of positive che
motaxis
IDA biological_process
GO:0051781 positive regulation of ce
ll division
IEA biological_process
GO:0060754 positive regulation of ma
st cell chemotaxis
IDA biological_process
GO:1901492 positive regulation of ly
mphangiogenesis
IEA biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001525 angiogenesis
IEA biological_process
GO:0001954 positive regulation of ce
ll-matrix adhesion
IEA biological_process
GO:0002052 positive regulation of ne
uroblast proliferation
IEA biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006929 substrate-dependent cell
migration
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0008083 growth factor activity
IEA molecular_function
GO:0008083 growth factor activity
IEA molecular_function
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0008285 negative regulation of ce
ll proliferation
IEA biological_process
GO:0009887 animal organ morphogenesi
s
IEA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016331 morphogenesis of embryoni
c epithelium
IEA biological_process
GO:0030154 cell differentiation
IEA biological_process
GO:0030947 regulation of vascular en
dothelial growth factor r
eceptor signaling pathway
IEA biological_process
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0031954 positive regulation of pr
otein autophosphorylation
IEA biological_process
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0042493 response to drug
IEA biological_process
GO:0043185 vascular endothelial grow
th factor receptor 3 bind
ing
IEA molecular_function
GO:0043536 positive regulation of bl
ood vessel endothelial ce
ll migration
IEA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0045776 negative regulation of bl
ood pressure
IEA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
IEA biological_process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0050679 positive regulation of ep
ithelial cell proliferati
on
IEA biological_process
GO:0050714 positive regulation of pr
otein secretion
IEA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
IEA biological_process
GO:0050918 positive chemotaxis
IEA biological_process
GO:0050930 induction of positive che
motaxis
IDA biological_process
GO:0051781 positive regulation of ce
ll division
IEA biological_process
GO:0060754 positive regulation of ma
st cell chemotaxis
IDA biological_process
GO:1901492 positive regulation of ly
mphangiogenesis
IEA biological_process
GO:0002576 platelet degranulation
TAS biological_process
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0006929 substrate-dependent cell
migration
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
TAS biological_process
GO:0031093 platelet alpha granule lu
men
TAS cellular_component
GO:0042056 chemoattractant activity
IDA molecular_function
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
TAS biological_process
GO:0050930 induction of positive che
motaxis
IDA biological_process
GO:0060754 positive regulation of ma
st cell chemotaxis
IDA biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04668  TNF signaling pathway

Diseases

Associated diseases References
Anoxia PMID: 20215856
Chorioamnionitis PMID: 20673868
Endometriosis PMID: 23585340
Angiogenesis in endometriosis INFBASE23334337
Endometriosis INFBASE23334337
Lymphedema PMID: 19002718
Ovarian cancer PMID: 20628624
Preeclampsia PMID: 20223440

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23334337 Endometrio
sis

15 (10 peritone
al endometriosi
s, 5 controls)
Female infertility VEGF-A
VEGF-B
VEGF-C
Show abstract
23585340 Endometrio
sis

79 (37 control,
42 endometrios
is)
NRP-1
NRP-2
VEGF-D
VEGF-C
Show abstract