Endometriosis Knowledgebase

Search Result

Gene id

7471

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

WNT1 Gene UCSC Ensembl

Aliases

BMND16, INT1, OI15

Gene name

Wnt family member 1

Alternate names

proto-oncogene Wnt-1, proto-oncogene Int-1 homolog, wingless-type MMTV integration site family member 1, wingless-type MMTV integration site family, member 1 (oncogene INT1),

Gene location

12q13.12 (48978452: 48982612) Exons: 4 NC_000012.12

Gene summary(Entrez)

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. [provided by RefSeq, Jul 2008]

OMIM

164820

Protein Summary

Protein general information

P04628

Name: Proto oncogene Wnt 1 (Proto oncogene Int 1 homolog)

Length: 370 Mass: 40,982

Sequence

MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQN
PGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIES
CTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSG
SCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Structural information

Interpro:	IPR005817 IPR009139 IPR018161
Prosite:	PS00246
Pfam:	PF00110
STRING:	ENSP00000293549;

Other Databases

GeneCards: WNT1; Malacards: WNT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000578	embryonic axis specificat ion	ISS	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005109	frizzled binding	IC	molecular_function
GO:0005109	frizzled binding	NAS	molecular_function
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007267	cell-cell signaling	ISS	biological_process
GO:0007520	myoblast fusion	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010592	positive regulation of la mellipodium assembly	IMP	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IDA	biological_process
GO:0016015	morphogen activity	TAS	molecular_function
GO:0016055	Wnt signaling pathway	IDA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0021527	spinal cord association n euron differentiation	IEA	biological_process
GO:0021536	diencephalon development	IEA	biological_process
GO:0021551	central nervous system mo rphogenesis	ISS	biological_process
GO:0021588	cerebellum formation	ISS	biological_process
GO:0021797	forebrain anterior/poster ior pattern specification	IEA	biological_process
GO:0022004	midbrain-hindbrain bounda ry maturation during brai n development	IEA	biological_process
GO:0022408	negative regulation of ce ll-cell adhesion	IMP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IEA	biological_process
GO:0030514	negative regulation of BM P signaling pathway	IMP	biological_process
GO:0030579	ubiquitin-dependent SMAD protein catabolic process	IEA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030901	midbrain development	ISS	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0033077	T cell differentiation in thymus	IEA	biological_process
GO:0033278	cell proliferation in mid brain	IEA	biological_process
GO:0042472	inner ear morphogenesis	IEA	biological_process
GO:0042770	signal transduction in re sponse to DNA damage	IDA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044336	canonical Wnt signaling p athway involved in negati ve regulation of apoptoti c process	IMP	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048018	receptor agonist activity	NAS	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0048664	neuron fate determination	IEA	biological_process
GO:0048666	neuron development	IEA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	ISS	biological_process
GO:0060061	Spemann organizer formati on	ISS	biological_process
GO:0060070	canonical Wnt signaling p athway	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	NAS	biological_process
GO:0060070	canonical Wnt signaling p athway	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0060348	bone development	IMP	biological_process
GO:0061184	positive regulation of de rmatome development	IDA	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0070365	hepatocyte differentiatio n	IEA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IEA	biological_process
GO:0071425	hematopoietic stem cell p roliferation	IEA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0090344	negative regulation of ce ll aging	IDA	biological_process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological_process
GO:1904953	Wnt signaling pathway inv olved in midbrain dopamin ergic neuron differentiat ion	NAS	biological_process
GO:1904953	Wnt signaling pathway inv olved in midbrain dopamin ergic neuron differentiat ion	TAS	biological_process
GO:1904954	canonical Wnt signaling p athway involved in midbra in dopaminergic neuron di fferentiation	TAS	biological_process
GO:1990403	embryonic brain developme nt	IEA	biological_process
GO:2000059	negative regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IEA	biological_process
GO:0000578	embryonic axis specificat ion	IEA	biological_process
GO:0000578	embryonic axis specificat ion	ISS	biological_process
GO:0001658	branching involved in ure teric bud morphogenesis	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005109	frizzled binding	IC	molecular_function
GO:0005109	frizzled binding	NAS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007267	cell-cell signaling	IEA	biological_process
GO:0007267	cell-cell signaling	ISS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007520	myoblast fusion	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010592	positive regulation of la mellipodium assembly	IMP	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IDA	biological_process
GO:0014902	myotube differentiation	IEA	biological_process
GO:0016015	morphogen activity	TAS	molecular_function
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	IDA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0021527	spinal cord association n euron differentiation	IEA	biological_process
GO:0021536	diencephalon development	IEA	biological_process
GO:0021549	cerebellum development	IEA	biological_process
GO:0021551	central nervous system mo rphogenesis	IEA	biological_process
GO:0021551	central nervous system mo rphogenesis	ISS	biological_process
GO:0021588	cerebellum formation	IEA	biological_process
GO:0021588	cerebellum formation	ISS	biological_process
GO:0021797	forebrain anterior/poster ior pattern specification	IEA	biological_process
GO:0022004	midbrain-hindbrain bounda ry maturation during brai n development	IEA	biological_process
GO:0022008	neurogenesis	IEA	biological_process
GO:0022037	metencephalon development	IEA	biological_process
GO:0022408	negative regulation of ce ll-cell adhesion	IMP	biological_process
GO:0030512	negative regulation of tr ansforming growth factor beta receptor signaling p athway	IEA	biological_process
GO:0030514	negative regulation of BM P signaling pathway	IMP	biological_process
GO:0030579	ubiquitin-dependent SMAD protein catabolic process	IEA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030901	midbrain development	IEA	biological_process
GO:0030901	midbrain development	ISS	biological_process
GO:0030917	midbrain-hindbrain bounda ry development	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0033077	T cell differentiation in thymus	IEA	biological_process
GO:0033278	cell proliferation in mid brain	IEA	biological_process
GO:0042472	inner ear morphogenesis	IEA	biological_process
GO:0042770	signal transduction in re sponse to DNA damage	IDA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044336	canonical Wnt signaling p athway involved in negati ve regulation of apoptoti c process	IMP	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048018	receptor agonist activity	NAS	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0048663	neuron fate commitment	IEA	biological_process
GO:0048664	neuron fate determination	IEA	biological_process
GO:0048666	neuron development	IEA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IEA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	ISS	biological_process
GO:0060061	Spemann organizer formati on	IEA	biological_process
GO:0060061	Spemann organizer formati on	ISS	biological_process
GO:0060070	canonical Wnt signaling p athway	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	NAS	biological_process
GO:0060070	canonical Wnt signaling p athway	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0060348	bone development	IMP	biological_process
GO:0061184	positive regulation of de rmatome development	IDA	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0070365	hepatocyte differentiatio n	IEA	biological_process
GO:0071375	cellular response to pept ide hormone stimulus	IEA	biological_process
GO:0071425	hematopoietic stem cell p roliferation	IEA	biological_process
GO:0071542	dopaminergic neuron diffe rentiation	IEA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0090344	negative regulation of ce ll aging	IDA	biological_process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological_process
GO:1904953	Wnt signaling pathway inv olved in midbrain dopamin ergic neuron differentiat ion	NAS	biological_process
GO:1904953	Wnt signaling pathway inv olved in midbrain dopamin ergic neuron differentiat ion	TAS	biological_process
GO:1904954	canonical Wnt signaling p athway involved in midbra in dopaminergic neuron di fferentiation	TAS	biological_process
GO:1990403	embryonic brain developme nt	IEA	biological_process
GO:2000059	negative regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IEA	biological_process
GO:0000578	embryonic axis specificat ion	ISS	biological_process
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005109	frizzled binding	IC	molecular_function
GO:0005109	frizzled binding	NAS	molecular_function
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007267	cell-cell signaling	ISS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0010592	positive regulation of la mellipodium assembly	IMP	biological_process
GO:0010812	negative regulation of ce ll-substrate adhesion	IDA	biological_process
GO:0016015	morphogen activity	TAS	molecular_function
GO:0016055	Wnt signaling pathway	IDA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0021551	central nervous system mo rphogenesis	ISS	biological_process
GO:0021588	cerebellum formation	ISS	biological_process
GO:0022408	negative regulation of ce ll-cell adhesion	IMP	biological_process
GO:0030514	negative regulation of BM P signaling pathway	IMP	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030901	midbrain development	ISS	biological_process
GO:0042770	signal transduction in re sponse to DNA damage	IDA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0044336	canonical Wnt signaling p athway involved in negati ve regulation of apoptoti c process	IMP	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	ISS	biological_process
GO:0045747	positive regulation of No tch signaling pathway	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048018	receptor agonist activity	NAS	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	ISS	biological_process
GO:0060061	Spemann organizer formati on	ISS	biological_process
GO:0060070	canonical Wnt signaling p athway	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	IMP	biological_process
GO:0060070	canonical Wnt signaling p athway	NAS	biological_process
GO:0060070	canonical Wnt signaling p athway	TAS	biological_process
GO:0060071	Wnt signaling pathway, pl anar cell polarity pathwa y	TAS	biological_process
GO:0060348	bone development	IMP	biological_process
GO:0061184	positive regulation of de rmatome development	IDA	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0090344	negative regulation of ce ll aging	IDA	biological_process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological_process
GO:1904953	Wnt signaling pathway inv olved in midbrain dopamin ergic neuron differentiat ion	NAS	biological_process
GO:1904953	Wnt signaling pathway inv olved in midbrain dopamin ergic neuron differentiat ion	TAS	biological_process
GO:1904954	canonical Wnt signaling p athway involved in midbra in dopaminergic neuron di fferentiation	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa05224  Breast cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04916  Melanogenesis
hsa05217  Basal cell carcinoma

Diseases

Associated diseases	References
Endometriosis	PMID: 24661731
Endometriosis	INFBASE24661731
Osteoporosis	KEGG: H01593, OMIM: 164820

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24661731	Endometrio sis			69 (30 with end ometriosis, 39 women undergoin g ICSI for male infertility)		WNT4 WNT5a WNT1 ?-catenin BMP4	Show abstract