Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 7472
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol WNT2   Gene   UCSC   Ensembl
Aliases INT1L1, IRP
Gene name Wnt family member 2
Alternate names protein Wnt-2, Int-1-related protein, int-1-like protein 1, secreted growth factor, wingless-type MMTV integration site family member 2,
Gene location 7q31.2 (117323288: 117276630)     Exons: 5     NC_000007.14
Gene summary(Entrez) This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]
OMIM 147870

Protein Summary

Protein general information P09544  

Name: Protein Wnt 2 (Int 1 like protein 1) (Int 1 related protein) (IRP)

Length: 360  Mass: 40,418

Tissue specificity: Expressed in brain in the thalamus, in fetal and adult lung and in placenta. {ECO

Sequence MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAE
CQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKG
IFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMA
DFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT
Structural information
Interpro:  IPR005817 IPR009140 IPR018161
Prosite:   PS00246

Pfam:  
PF00110
STRING:   ENSP00000265441;
Other Databases GeneCards:  WNT2;  Malacards:  WNT2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IEA biological_process
GO:0002053 positive regulation of me
senchymal cell proliferat
ion
IEA biological_process
GO:0002088 lens development in camer
a-type eye
ISS biological_process
GO:0005109 frizzled binding
IPI molecular_function
GO:0005109 frizzled binding
IPI molecular_function
GO:0005109 frizzled binding
IPI molecular_function
GO:0005125 cytokine activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0007267 cell-cell signaling
IDA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0016055 Wnt signaling pathway
IDA biological_process
GO:0016055 Wnt signaling pathway
TAS biological_process
GO:0022008 neurogenesis
TAS biological_process
GO:0030182 neuron differentiation
ISS biological_process
GO:0030324 lung development
IEA biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0033278 cell proliferation in mid
brain
IDA biological_process
GO:0045165 cell fate commitment
IBA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0048018 receptor agonist activity
IDA molecular_function
GO:0048018 receptor agonist activity
IC molecular_function
GO:0048146 positive regulation of fi
broblast proliferation
IMP biological_process
GO:0050769 positive regulation of ne
urogenesis
IEA biological_process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
IDA biological_process
GO:0055009 atrial cardiac muscle tis
sue morphogenesis
IEA biological_process
GO:0060045 positive regulation of ca
rdiac muscle cell prolife
ration
IEA biological_process
GO:0060070 canonical Wnt signaling p
athway
IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
TAS biological_process
GO:0060317 cardiac epithelial to mes
enchymal transition
IEA biological_process
GO:0060492 lung induction
IEA biological_process
GO:0060501 positive regulation of ep
ithelial cell proliferati
on involved in lung morph
ogenesis
IEA biological_process
GO:0060716 labyrinthine layer blood
vessel development
IEA biological_process
GO:0061072 iris morphogenesis
ISS biological_process
GO:0061180 mammary gland epithelium
development
IEP biological_process
GO:0071300 cellular response to reti
noic acid
ISS biological_process
GO:0071560 cellular response to tran
sforming growth factor be
ta stimulus
IEP biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IMP biological_process
GO:1904948 midbrain dopaminergic neu
ron differentiation
IDA biological_process
GO:1990909 Wnt signalosome
IC cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
IEA biological_process
GO:0002053 positive regulation of me
senchymal cell proliferat
ion
IEA biological_process
GO:0002088 lens development in camer
a-type eye
ISS biological_process
GO:0005102 receptor binding
IEA molecular_function
GO:0005109 frizzled binding
IPI molecular_function
GO:0005109 frizzled binding
IPI molecular_function
GO:0005109 frizzled binding
IPI molecular_function
GO:0005125 cytokine activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0005578 proteinaceous extracellul
ar matrix
IEA cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0007267 cell-cell signaling
IDA biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0016055 Wnt signaling pathway
IEA biological_process
GO:0016055 Wnt signaling pathway
IEA biological_process
GO:0016055 Wnt signaling pathway
IEA biological_process
GO:0016055 Wnt signaling pathway
IDA biological_process
GO:0016055 Wnt signaling pathway
TAS biological_process
GO:0022008 neurogenesis
TAS biological_process
GO:0030182 neuron differentiation
ISS biological_process
GO:0030324 lung development
IEA biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0033278 cell proliferation in mid
brain
IEA biological_process
GO:0033278 cell proliferation in mid
brain
IDA biological_process
GO:0045165 cell fate commitment
IBA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IEA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0048018 receptor agonist activity
IDA molecular_function
GO:0048018 receptor agonist activity
IC molecular_function
GO:0048146 positive regulation of fi
broblast proliferation
IMP biological_process
GO:0050769 positive regulation of ne
urogenesis
IEA biological_process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
IDA biological_process
GO:0055009 atrial cardiac muscle tis
sue morphogenesis
IEA biological_process
GO:0060045 positive regulation of ca
rdiac muscle cell prolife
ration
IEA biological_process
GO:0060070 canonical Wnt signaling p
athway
IEA biological_process
GO:0060070 canonical Wnt signaling p
athway
IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
TAS biological_process
GO:0060317 cardiac epithelial to mes
enchymal transition
IEA biological_process
GO:0060492 lung induction
IEA biological_process
GO:0060501 positive regulation of ep
ithelial cell proliferati
on involved in lung morph
ogenesis
IEA biological_process
GO:0060716 labyrinthine layer blood
vessel development
IEA biological_process
GO:0061072 iris morphogenesis
ISS biological_process
GO:0061180 mammary gland epithelium
development
IEP biological_process
GO:0071300 cellular response to reti
noic acid
ISS biological_process
GO:0071560 cellular response to tran
sforming growth factor be
ta stimulus
IEP biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IMP biological_process
GO:1904948 midbrain dopaminergic neu
ron differentiation
IDA biological_process
GO:1990909 Wnt signalosome
IC cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0002088 lens development in camer
a-type eye
ISS biological_process
GO:0005109 frizzled binding
IPI molecular_function
GO:0005109 frizzled binding
IPI molecular_function
GO:0005109 frizzled binding
IPI molecular_function
GO:0005125 cytokine activity
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
NAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IBA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0007267 cell-cell signaling
IDA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological_process
GO:0016055 Wnt signaling pathway
IDA biological_process
GO:0016055 Wnt signaling pathway
TAS biological_process
GO:0022008 neurogenesis
TAS biological_process
GO:0030182 neuron differentiation
ISS biological_process
GO:0031012 extracellular matrix
IDA cellular_component
GO:0033278 cell proliferation in mid
brain
IDA biological_process
GO:0045165 cell fate commitment
IBA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0048018 receptor agonist activity
IDA molecular_function
GO:0048018 receptor agonist activity
IC molecular_function
GO:0048146 positive regulation of fi
broblast proliferation
IMP biological_process
GO:0051091 positive regulation of se
quence-specific DNA bindi
ng transcription factor a
ctivity
IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
IDA biological_process
GO:0060070 canonical Wnt signaling p
athway
TAS biological_process
GO:0061072 iris morphogenesis
ISS biological_process
GO:0061180 mammary gland epithelium
development
IEP biological_process
GO:0071300 cellular response to reti
noic acid
ISS biological_process
GO:0071560 cellular response to tran
sforming growth factor be
ta stimulus
IEP biological_process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
IMP biological_process
GO:1904948 midbrain dopaminergic neu
ron differentiation
IDA biological_process
GO:1990909 Wnt signalosome
IC cellular_component
GO:0005886 plasma membrane
IDA cellular_component

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa05224  Breast cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04916  Melanogenesis
hsa05217  Basal cell carcinoma

Diseases

Associated diseases References
Autism PMID: 11840514
Cardiovascular disease PMID: 17903304
Dupuytren contracture PMID: 21732829
Endometriosis PMID: 22259059
Endometriosis INFBASE22259059

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
22259059 Endometrio
sis



Show abstract