Endometriosis Knowledgebase

Search Result

Gene id

7476

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

WNT7A Gene UCSC Ensembl

Gene name

Wnt family member 7A

Alternate names

protein Wnt-7a, proto-oncogene Wnt7a protein, wingless-type MMTV integration site family, member 7A,

Gene location

3p25.1 (13880120: 13818107) Exons: 6 NC_000003.12

Gene summary(Entrez)

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi/Raas-Rothschild/Schinzel phocomelia syndromes. [provided by RefSeq, Jul 2008]

OMIM

601570

Protein Summary

Protein general information

O00755

Name: Protein Wnt 7a

Length: 349 Mass: 39,005

Tissue specificity: Expression is restricted to placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain.

Sequence

MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQF
QFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWG
GCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELG
YVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK

Structural information

Interpro:	IPR005817 IPR013300 IPR018161
Prosite:	PS00246
Pfam:	PF00110
PDB:	4UZQ
PDBsum:	4UZQ
DIP:	61511
MINT:	1379349
STRING:	ENSP00000285018;

Other Databases

GeneCards: WNT7A; Malacards: WNT7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000578	embryonic axis specificat ion	IMP	biological_process
GO:0001502	cartilage condensation	IDA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0002062	chondrocyte differentiati on	IDA	biological_process
GO:0005102	receptor binding	IPI	molecular_function
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007269	neurotransmitter secretio n	IEA	biological_process
GO:0007409	axonogenesis	TAS	biological_process
GO:0007416	synapse assembly	TAS	biological_process
GO:0007548	sex differentiation	TAS	biological_process
GO:0008105	asymmetric protein locali zation	IEA	biological_process
GO:0009953	dorsal/ventral pattern fo rmation	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IEA	biological_process
GO:0014719	skeletal muscle satellite cell activation	IEA	biological_process
GO:0014834	skeletal muscle satellite cell maintenance involve d in skeletal muscle rege neration	IEA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0021707	cerebellar granule cell d ifferentiation	IEA	biological_process
GO:0021846	cell proliferation in for ebrain	IDA	biological_process
GO:0022009	central nervous system va sculogenesis	IEA	biological_process
GO:0030010	establishment of cell pol arity	IEA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0031133	regulation of axon diamet er	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	IEA	biological_process
GO:0035115	embryonic forelimb morpho genesis	IMP	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IMP	biological_process
GO:0035567	non-canonical Wnt signali ng pathway	IEA	biological_process
GO:0035659	Wnt signaling pathway inv olved in wound healing, s preading of epidermal cel ls	IDA	biological_process
GO:0036465	synaptic vesicle recyclin g	TAS	biological_process
GO:0042733	embryonic digit morphogen esis	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IEA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048018	receptor agonist activity	IDA	molecular_function
GO:0048103	somatic stem cell divisio n	IEA	biological_process
GO:0048864	stem cell development	IDA	biological_process
GO:0050768	negative regulation of ne urogenesis	IDA	biological_process
GO:0051965	positive regulation of sy napse assembly	IDA	biological_process
GO:0060021	palate development	IMP	biological_process
GO:0060054	positive regulation of ep ithelial cell proliferati on involved in wound heal ing	IDA	biological_process
GO:0060066	oviduct development	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060997	dendritic spine morphogen esis	IDA	biological_process
GO:0061038	uterus morphogenesis	IEA	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0070307	lens fiber cell developme nt	ISS	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEP	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0098793	presynapse	IEA	cellular_component
GO:1902474	positive regulation of pr otein localization to syn apse	TAS	biological_process
GO:1904861	excitatory synapse assemb ly	TAS	biological_process
GO:1904891	positive regulation of ex citatory synapse assembly	IDA	biological_process
GO:2000463	positive regulation of ex citatory postsynaptic pot ential	IDA	biological_process
GO:0000578	embryonic axis specificat ion	IMP	biological_process
GO:0001502	cartilage condensation	IDA	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0002062	chondrocyte differentiati on	IDA	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	NAS	molecular_function
GO:0005109	frizzled binding	IEA	molecular_function
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007269	neurotransmitter secretio n	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007409	axonogenesis	TAS	biological_process
GO:0007416	synapse assembly	TAS	biological_process
GO:0007548	sex differentiation	TAS	biological_process
GO:0008105	asymmetric protein locali zation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009953	dorsal/ventral pattern fo rmation	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010595	positive regulation of en dothelial cell migration	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0014719	skeletal muscle satellite cell activation	IEA	biological_process
GO:0014834	skeletal muscle satellite cell maintenance involve d in skeletal muscle rege neration	IEA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	IEA	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0021707	cerebellar granule cell d ifferentiation	IEA	biological_process
GO:0021846	cell proliferation in for ebrain	IDA	biological_process
GO:0022009	central nervous system va sculogenesis	IEA	biological_process
GO:0030010	establishment of cell pol arity	IEA	biological_process
GO:0030326	embryonic limb morphogene sis	IEA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0031133	regulation of axon diamet er	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	IEA	biological_process
GO:0035115	embryonic forelimb morpho genesis	IEA	biological_process
GO:0035115	embryonic forelimb morpho genesis	IMP	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IEA	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IMP	biological_process
GO:0035567	non-canonical Wnt signali ng pathway	IEA	biological_process
GO:0035659	Wnt signaling pathway inv olved in wound healing, s preading of epidermal cel ls	IDA	biological_process
GO:0036465	synaptic vesicle recyclin g	TAS	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042733	embryonic digit morphogen esis	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IEA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048018	receptor agonist activity	IDA	molecular_function
GO:0048103	somatic stem cell divisio n	IEA	biological_process
GO:0048864	stem cell development	IDA	biological_process
GO:0050768	negative regulation of ne urogenesis	IDA	biological_process
GO:0050770	regulation of axonogenesi s	IEA	biological_process
GO:0050808	synapse organization	IEA	biological_process
GO:0051216	cartilage development	IEA	biological_process
GO:0051965	positive regulation of sy napse assembly	IEA	biological_process
GO:0051965	positive regulation of sy napse assembly	IDA	biological_process
GO:0060021	palate development	IMP	biological_process
GO:0060054	positive regulation of ep ithelial cell proliferati on involved in wound heal ing	IDA	biological_process
GO:0060065	uterus development	IEA	biological_process
GO:0060066	oviduct development	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IEA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060173	limb development	IEA	biological_process
GO:0060997	dendritic spine morphogen esis	IEA	biological_process
GO:0060997	dendritic spine morphogen esis	IDA	biological_process
GO:0061038	uterus morphogenesis	IEA	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0070307	lens fiber cell developme nt	ISS	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEP	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0098793	presynapse	IEA	cellular_component
GO:1902474	positive regulation of pr otein localization to syn apse	TAS	biological_process
GO:1904861	excitatory synapse assemb ly	TAS	biological_process
GO:1904891	positive regulation of ex citatory synapse assembly	IDA	biological_process
GO:2000463	positive regulation of ex citatory postsynaptic pot ential	IEA	biological_process
GO:2000463	positive regulation of ex citatory postsynaptic pot ential	IDA	biological_process
GO:0000578	embryonic axis specificat ion	IMP	biological_process
GO:0001502	cartilage condensation	IDA	biological_process
GO:0002062	chondrocyte differentiati on	IDA	biological_process
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	NAS	molecular_function
GO:0005109	frizzled binding	IBA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007409	axonogenesis	TAS	biological_process
GO:0007416	synapse assembly	TAS	biological_process
GO:0007548	sex differentiation	TAS	biological_process
GO:0016055	Wnt signaling pathway	TAS	biological_process
GO:0021846	cell proliferation in for ebrain	IDA	biological_process
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0035115	embryonic forelimb morpho genesis	IMP	biological_process
GO:0035116	embryonic hindlimb morpho genesis	IMP	biological_process
GO:0035659	Wnt signaling pathway inv olved in wound healing, s preading of epidermal cel ls	IDA	biological_process
GO:0036465	synaptic vesicle recyclin g	TAS	biological_process
GO:0042733	embryonic digit morphogen esis	IMP	biological_process
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048018	receptor agonist activity	IC	molecular_function
GO:0048018	receptor agonist activity	IDA	molecular_function
GO:0048864	stem cell development	IDA	biological_process
GO:0050768	negative regulation of ne urogenesis	IDA	biological_process
GO:0051965	positive regulation of sy napse assembly	IDA	biological_process
GO:0060021	palate development	IMP	biological_process
GO:0060054	positive regulation of ep ithelial cell proliferati on involved in wound heal ing	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060070	canonical Wnt signaling p athway	IDA	biological_process
GO:0060997	dendritic spine morphogen esis	IDA	biological_process
GO:0070062	extracellular exosome	TAS	cellular_component
GO:0070307	lens fiber cell developme nt	ISS	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEP	biological_process
GO:1902474	positive regulation of pr otein localization to syn apse	TAS	biological_process
GO:1904861	excitatory synapse assemb ly	TAS	biological_process
GO:1904891	positive regulation of ex citatory synapse assembly	IDA	biological_process
GO:2000463	positive regulation of ex citatory postsynaptic pot ential	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa05224  Breast cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04916  Melanogenesis
hsa05217  Basal cell carcinoma

Diseases

Associated diseases	References
Endometriosis	PMID: 17588571
Fuhrmann syndrome	KEGG: H00846, OMIM: 601570
Endometriosis	INFBASE17588571
Raas-Rothschild syndrome	KEGG: H00847

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17588571	Endometrio sis					WNT7A	Show abstract