Endometriosis Knowledgebase

Search Result

Gene id

7517

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

XRCC3 Gene UCSC Ensembl

Aliases

CMM6

Gene name

X-ray repair cross complementing 3

Alternate names

DNA repair protein XRCC3, X-ray repair complementing defective repair in Chinese hamster cells 3, X-ray repair cross-complementing protein 3,

Gene location

14q32.33 (103715485: 103697610) Exons: 10 NC_000014.9

Gene summary(Entrez)

This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents and is chromosomally unstable. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

OMIM

600675

Protein Summary

Protein general information

O43542

Name: DNA repair protein XRCC3 (X ray repair cross complementing protein 3)

Length: 346 Mass: 37,850

Sequence

MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERF
PTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKR
LQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDS
QASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR
LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH

Structural information

Interpro:	IPR013632 IPR016467 IPR027417 IPR033925 IPR020588
Prosite:	PS50162
Pfam:	PF08423
CDD:	cd01123
DIP:	42016
MINT:	204782
STRING:	ENSP00000343392;

Other Databases

GeneCards: XRCC3; Malacards: XRCC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000150	recombinase activity	IBA	molecular_function
GO:0000707	meiotic DNA recombinase a ssembly	IBA	biological_process
GO:0000722	telomere maintenance via recombination	IMP	biological_process
GO:0000724	double-strand break repai r via homologous recombin ation	IMP	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0000784	nuclear chromosome, telom eric region	IC	cellular_component
GO:0003690	double-stranded DNA bindi ng	IBA	molecular_function
GO:0003697	single-stranded DNA bindi ng	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005657	replication fork	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0006281	DNA repair	IGI	biological_process
GO:0006310	DNA recombination	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0007131	reciprocal meiotic recomb ination	IBA	biological_process
GO:0008094	DNA-dependent ATPase acti vity	IBA	molecular_function
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010212	response to ionizing radi ation	IBA	biological_process
GO:0010824	regulation of centrosome duplication	IMP	biological_process
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC 2 complex	IBA	cellular_component
GO:0033065	Rad51C-XRCC3 complex	IDA	cellular_component
GO:0042148	strand invasion	IBA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0071140	resolution of mitotic rec ombination intermediates	IMP	biological_process
GO:0090267	positive regulation of mi totic cell cycle spindle assembly checkpoint	IMP	biological_process
GO:0090656	t-circle formation	IC	biological_process
GO:0090656	t-circle formation	IMP	biological_process
GO:0000400	four-way junction DNA bin ding	IDA	molecular_function
GO:0008821	crossover junction endode oxyribonuclease activity	IMP	molecular_function
GO:0008821	crossover junction endode oxyribonuclease activity	IMP	molecular_function
GO:0000150	recombinase activity	IBA	molecular_function
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000707	meiotic DNA recombinase a ssembly	IBA	biological_process
GO:0000722	telomere maintenance via recombination	IMP	biological_process
GO:0000724	double-strand break repai r via homologous recombin ation	IMP	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0000784	nuclear chromosome, telom eric region	IC	cellular_component
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IBA	molecular_function
GO:0003697	single-stranded DNA bindi ng	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005657	replication fork	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0006281	DNA repair	IEA	biological_process
GO:0006281	DNA repair	IEA	biological_process
GO:0006281	DNA repair	IGI	biological_process
GO:0006281	DNA repair	TAS	biological_process
GO:0006310	DNA recombination	IEA	biological_process
GO:0006310	DNA recombination	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0007131	reciprocal meiotic recomb ination	IBA	biological_process
GO:0008094	DNA-dependent ATPase acti vity	IEA	molecular_function
GO:0008094	DNA-dependent ATPase acti vity	IBA	molecular_function
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010212	response to ionizing radi ation	IBA	biological_process
GO:0010824	regulation of centrosome duplication	IMP	biological_process
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC 2 complex	IBA	cellular_component
GO:0033065	Rad51C-XRCC3 complex	IDA	cellular_component
GO:0042148	strand invasion	IBA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0071140	resolution of mitotic rec ombination intermediates	IMP	biological_process
GO:0090267	positive regulation of mi totic cell cycle spindle assembly checkpoint	IMP	biological_process
GO:0090656	t-circle formation	IC	biological_process
GO:0090656	t-circle formation	IMP	biological_process
GO:0000400	four-way junction DNA bin ding	IDA	molecular_function
GO:0008821	crossover junction endode oxyribonuclease activity	IMP	molecular_function
GO:0008821	crossover junction endode oxyribonuclease activity	IMP	molecular_function
GO:0000150	recombinase activity	IBA	molecular_function
GO:0000707	meiotic DNA recombinase a ssembly	IBA	biological_process
GO:0000722	telomere maintenance via recombination	IMP	biological_process
GO:0000724	double-strand break repai r via homologous recombin ation	IMP	biological_process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological_process
GO:0000732	strand displacement	TAS	biological_process
GO:0000784	nuclear chromosome, telom eric region	IC	cellular_component
GO:0003690	double-stranded DNA bindi ng	IBA	molecular_function
GO:0003697	single-stranded DNA bindi ng	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005657	replication fork	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0006281	DNA repair	IGI	biological_process
GO:0006281	DNA repair	TAS	biological_process
GO:0006310	DNA recombination	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0007131	reciprocal meiotic recomb ination	IBA	biological_process
GO:0008094	DNA-dependent ATPase acti vity	IBA	molecular_function
GO:0010212	response to ionizing radi ation	IBA	biological_process
GO:0010824	regulation of centrosome duplication	IMP	biological_process
GO:0033063	Rad51B-Rad51C-Rad51D-XRCC 2 complex	IBA	cellular_component
GO:0033065	Rad51C-XRCC3 complex	IDA	cellular_component
GO:0042148	strand invasion	IBA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0071140	resolution of mitotic rec ombination intermediates	IMP	biological_process
GO:0090267	positive regulation of mi totic cell cycle spindle assembly checkpoint	IMP	biological_process
GO:0090656	t-circle formation	IC	biological_process
GO:0090656	t-circle formation	IMP	biological_process
GO:0000400	four-way junction DNA bin ding	IDA	molecular_function
GO:0008821	crossover junction endode oxyribonuclease activity	IMP	molecular_function
GO:0008821	crossover junction endode oxyribonuclease activity	IMP	molecular_function

KEGG pathways

hsa03440 Homologous recombination

Diseases

Associated diseases	References
Breast cancer	OMIM: 600675
Endometriosis	PMID: 24615029
Ovarian cancer	INFBASE24615029
Endometriosis	INFBASE24615029
Melanoma	OMIM: 600675
Neural tube defects	PMID: 15887293

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24615029	Endometrio sis	(XRCC1 codons 194 and 399, XPD codons 312 and 751, and XRCC3 codon 241), (BLHX codon 443)		212 (72 patient s with endometr iosis, 70 with ovarian cancer, and 70 healthy individuals (c ontrols))		BLMH XRCC1 XRCC3	Show abstract